KEGG   Homo sapiens (human): 3782Help
Entry
3782              CDS       T01001                                 

Gene name
KCNN3, KCa2.3, SK3, SKCA3, hSK3
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 3
  KO
K04944  
potassium intermediate/small conductance calcium-activated channel subfamily N member 3
Organism
hsa  Homo sapiens (human)
Pathway
Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    3782 (KCNN3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNN, KCa2-3.x (Small conductance)
   3782 (KCNN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.3
AA seq 731 aa AA seqDB search
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQ
PQPPQLQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAIL
HPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKY
SGGVMKPLSRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNAT
HNHQHAGTTASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVI
ETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTY
ERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIAR
VMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRV
CERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVA
VVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKH
QRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLE
SKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTS
FPTPYTSSSSC
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggacacttctgggcacttccatgactcgggggtgggggacttggatgaagaccccaag
tgcccctgtccatcctctggggatgagcagcagcagcagcagcagcagcaacagcagcag
cagccaccaccgccagcgccaccagcagccccccagcagcccctgggaccctcgctgcag
cctcagcctccgcagcttcagcagcagcagcagcagcagcagcagcagcagcagcagcag
ccaccgcatcccctgtctcagctcgcccaactccagagccagcccgtccaccctggcctg
ctgcactcctctcccaccgctttcagggcccccccttcgtccaactccaccgccatcctc
cacccttcctccaggcaaggcagccagctcaatctcaatgaccacttgcttggccactct
ccaagttccacagctacaagtgggcctggcggaggcagccggcaccgacaggccagcccc
ctggtgcaccggcgggacagcaaccccttcacggagatcgccatgagctcctgcaagtat
agcggtggggtcatgaagcccctcagccgcctcagcgcctcccggaggaacctcatcgag
gccgagactgagggccaacccctccagcttttcagccctagcaaccccccggagatcgtc
atctcctcccgggaggacaaccatgcccaccagaccctgctccatcaccctaatgccacc
cacaaccaccagcatgccggcaccaccgccagcagcaccaccttccccaaagccaacaag
cggaaaaaccaaaacattggctataagctgggacacaggagggccctgtttgaaaagaga
aagcgactgagtgactatgctctgatttttgggatgtttggaattgttgttatggtgata
gagaccgagctctcttggggtttgtactcaaaggactccatgttttcgttggccctgaaa
tgccttatcagtctgtccaccatcatccttttgggcttgatcatcgcctaccacacacgt
gaagtccagctcttcgtgatcgacaatggcgcggatgactggcggatagccatgacctac
gagcgcatcctgtacatcagcctggagatgctggtgtgcgccatccaccccattcctggc
gagtacaagttcttctggacggcacgcctggccttctcctacacaccctcccgggcggag
gccgatgtggacatcatcctgtctatccccatgttcctgcgcctgtacctgatcgcccga
gtcatgctgctgcacagcaagctcttcaccgatgcctcgtcccgcagcatcggggccctc
aacaagatcaacttcaacacccgctttgtcatgaagacgctcatgaccatctgccctggc
actgtgctgctcgtgttcagcatctctctgtggatcattgctgcctggaccgtccgtgtc
tgtgaaaggtaccatgaccagcaggacgtaactagtaactttctgggtgccatgtggctc
atctccatcacattcctttccattggttatggggacatggtgccccacacatactgtggg
aaaggtgtctgtctcctcactggcatcatgggtgcaggctgcactgcccttgtggtggcc
gtggtggcccgaaagctggaactcaccaaagcggagaagcacgttcataacttcatgatg
gacactcagctcaccaagcggatcaagaatgctgcagccaatgtccttcgggaaacatgg
ttaatctataaacacacaaagctgctaaagaagattgaccatgccaaagtgaggaaacac
cagaggaagttcctccaagctatccaccagttgaggagcgtcaagatggaacagaggaag
ctgagtgaccaagccaacactctggtggacctttccaagatgcagaatgtcatgtatgac
ttaatcacagaactcaatgaccggagcgaagacctggagaagcagattggcagcctggag
tcgaagctggagcatctcaccgccagcttcaactccctgccgctgctcatcgccgacacc
ctgcgccagcagcagcagcagctcctgtctgccatcatcgaggcccggggtgtcagcgtg
gcagtgggcaccacccacaccccaatctccgatagccccattggggtcagctccacctcc
ttcccgaccccgtacacaagttcaagcagttgctaa

DBGET integrated database retrieval system