KEGG   Homo sapiens (human): 3786Help
Entry
3786              CDS       T01001                                 

Gene name
KCNQ3, BFNC2, EBN2, KV7.3
Definition
potassium voltage-gated channel, KQT-like subfamily, member 3
Orthology
K04928  
potassium voltage-gated channel KQT-like subfamily member 3
Organism
hsa  Homo sapiens (human)
Pathway
Cholinergic synapse
Disease
H00806  
Benign familial neonatal and infantile epilepsies
Drug target
Retigabine: 
Linopirdine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    3786 (KCNQ3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNQ, Kv7.x (KQT-like)
   3786 (KCNQ3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24
AA seq 752 aa AA seqDB search
MKPAEHATMFLIVLGCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGC
CCRYKGWRGRLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRM
DRRGGTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKEEF
ETYADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQ
EQHRQKHFEKRRKPAAELIQAAWRYYATNPNRIDLVATWRFYESVVSFPFFRKEQLEAAS
SQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKA
YAFWQSSEDAGTGDPMAEDRGYGNDFPIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRP
YDVKDVIEQYSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTFPSQQSPR
NEPYVARPSTSEIEDQSMMGKFVKVERQVQDMGKKLDFLVDMHMQHMERLQVQVTEYYPT
KGTSSPAEAEKKEDNRYSDLKTIICNYSETGPPEPPYSFHQVTIDKVSPYGFFAHDPVNL
PRGGPSSGKVQATPPSSATTYVERPTVLPILTLLDSRVSCHSQADLQGPYSDRISPRQRR
SITRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYVFGPNGGSSWMREKRYLAEGETDT
DTDPFTPSGSMPLSSTGDGISDSVWTPSNKPI
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgcagaacacgccacgatgttcctgattgtcctggggtgcttgattctggct
gtcctgaccacattcaaggagtatgagactgtctcgggagactggcttctgttactggag
acatttgctattttcatctttggagccgagtttgctttgaggatctgggctgctggatgt
tgctgccgatacaaaggctggcggggccgactgaagtttgccaggaagcccctgtgcatg
ttggacatctttgtgctgattgcctctgtgccagtggttgctgtgggaaaccaaggcaat
gttctggccacctccctgcgaagcctgcgcttcctgcagatcctgcgcatgctgcggatg
gaccggagaggtggcacctggaagcttctgggctcagccatctgtgcccacagcaaagaa
ctcatcacggcctggtacatcggtttcctgacactcatcctttcttcatttcttgtctac
ctggttgagaaagacgtcccagaggtggatgcacaaggagaggagatgaaagaggagttt
gagacctatgcagatgccctgtggtggggcctgatcacactggccaccattggctatgga
gacaagacacccaaaacgtgggaaggccgtctgattgccgccaccttttccttaattggc
gtctccttttttgcccttccagcgggcatcctggggtccgggctggccctcaaggtgcag
gagcaacaccgtcagaagcactttgagaaaaggaggaagccagctgctgagctcattcag
gctgcctggaggtattatgctaccaaccccaacaggattgacctggtggcgacatggaga
ttttatgaatcagtcgtctcttttcctttcttcaggaaagaacagctggaggcagcatcc
agccaaaagctgggtctcttggatcgggttcgcctttctaatcctcgtggtagcaatact
aaaggaaagctatttacccctctgaatgtagatgccatagaagaaagtccttctaaagaa
ccaaagcctgttggcttaaacaataaagagcgtttccgcacggccttccgcatgaaagcc
tacgctttctggcagagttctgaagatgccgggacaggtgaccccatggcggaagacagg
ggctatgggaatgacttccccatcgaagacatgatccccaccctgaaggccgccatccga
gccgtcagaattctacaattccgtctctataaaaaaaaattcaaggagactttgaggcct
tacgatgtgaaggatgtgattgagcagtattctgccgggcatctcgacatgctttccagg
ataaagtaccttcagacgagaatagatatgattttcacccctggacctccctccacgcca
aaacacaagaagtctcagaaagggtcagcattcaccttcccatcccagcaatctcccagg
aatgaaccatatgtagccagaccatccacatcagaaatcgaagaccaaagcatgatgggg
aagtttgtaaaagttgaaagacaggttcaggacatggggaagaagctggacttcctcgtg
gatatgcacatgcaacacatggaacggttgcaggtgcaggtcacggagtattacccaacc
aagggcacctcctcgccagctgaagcagagaagaaggaggacaacaggtattccgatttg
aaaaccatcatctgcaactattctgagacaggccccccggaaccaccctacagcttccac
caggtgaccattgacaaagtcagcccctatgggttttttgcacatgaccctgtgaacctg
ccccgagggggacccagttctggaaaggttcaggcaactcctccttcctcagcaacaacg
tatgtggagaggcccacggtcctgcctatcttgactcttctcgactcccgagtgagctgc
cactcccaggctgacctgcagggcccctactcggaccgaatctccccccggcagagacgt
agcatcacgcgagacagtgacacacctctgtccctgatgtcggtcaaccacgaggagctg
gagaggtctccaagtggcttcagcatctcccaggacagagatgattatgtgttcggcccc
aatggggggtcgagctggatgagggagaagcggtacctcgccgagggtgagacggacaca
gacacggaccccttcacgcccagcggctccatgcctctgtcgtccacaggggatgggatt
tctgattcagtatggaccccttccaataagcccatttaa

DBGET integrated database retrieval system