KEGG   Homo sapiens (human): 3787Help
Entry
3787              CDS       T01001                                 

Gene name
KCNS1, Kv9.1
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily S member 1
  KO
K04931  
potassium voltage-gated channel delayed-rectifier subfamily S member 1
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNS, Kv9.x (Delayed-rectifier)
   3787 (KCNS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q12
AA seq 526 aa AA seqDB search
MLMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR
RQLSARALARFPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFYRT
GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC
PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH
SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF
FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST
GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT
TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQ
EFEDLLSSIDGVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgctgctggtccggggaacacactatgagaacctccggtctaaagtggtgctg
ccaacacccctaggagggaggagcactgaaacctttgtgagcgagttcccgggccccgac
accgggatccgctggcggcgaagcgacgaggcgctgcgcgtgaacgtgggtggcgtgcgg
cggcagctgagcgcgcgcgccctggcgcgcttcccgggcacgcggctgggccgcctgcag
gccgcggcgtcggaggagcaggcgcggcgcctgtgcgacgactacgacgaggcggcgcgc
gaattctacttcgaccggcacccgggcttcttcctgagcctgctgcacttctaccgcact
ggccacctgcacgtgctcgacgagctgtgcgtcttcgcctttggccaggaggccgactac
tggggcctaggcgagaacgcgcttgccgcgtgctgccgcgcgcgctacctggagaggcgg
ctgacccagccgcacgcctgggacgaggacagcgacacgccgagcagcgtggacccgtgc
cccgacgagatctccgacgtgcagcgagaactggcgcgctatggcgcggcgcgctgtggc
cgcctgcgccgccgcctctggctgaccatggagaacccgggctactcgctgccgagcaag
ctcttcagctgcgtctccatcagcgtggtgctcgcctccatcgccgccatgtgcatccac
agcctgcccgagtaccaggcccgcgaggcggcggccgccgtggctgcggtggccgcgggc
cgcagcccggaaggcgtgcgcgacgacccggtgctgcgacgcctcgagtacttctgcatc
gcctggttcagcttcgaggtgtcgtcgcgcctcctgctggcgcccagtacgcgcaacttc
ttctgccacccgctcaacctcatcgacattgtgtctgtgctgcccttctatctcacgctg
ctggctggtgtggcactgggcgaccagggcggcaaggagttcggccacctgggcaaggtg
gtgcaggtgttccgcctcatgcgcatcttccgcgtactcaagttggcgcgccattccacc
gggctgcgctcgctgggagccacgctcaagcacagctaccgtgaggtgggcatcttgctg
ctgtacctggctgtgggtgtgtcagtgttctctggtgtggcctacacagctgaaaaggag
gaggacgtgggctttaacaccatcccagcctgctggtggtggggcacagtgagcatgacc
accgtgggctatggggatgtggtgccagtgacggtggctggcaagctggcagcctcaggc
tgcatcctagggggcatcctggtggtagcactccccatcaccatcatcttcaacaagttc
tcccacttctaccggcgccagaaggctctggaggcagccgtgcgcaacagcaaccaccaa
gagtttgaggacttgctgagcagcattgatggggtgtcggaggcatctctggagacatcc
cgagaaacctctcaggagggacagtctgcagatctagagagccaggcccccagtgagcct
ccacaccctcagatgtattaa

DBGET integrated database retrieval system