KEGG   Homo sapiens (human): 3788Help
Entry
3788              CDS       T01001                                 

Gene name
KCNS2, KV9.2
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily S member 2
  KO
K04932  
potassium voltage-gated channel delayed-rectifier subfamily S member 2
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNS, Kv9.x (Delayed-rectifier)
   3788 (KCNS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
8q22
AA seq 477 aa AA seqDB search
MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCD
DYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCS
YSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNP
GYSVLSRVFSILSILVVMGSIITMCLNSLPDFQIPDSQGNPGEDPRFEIVEHFGIAWFTF
ELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLM
RIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLAT
IPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ
KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLR
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccagagcctgtgggacgtgtcggaggctaacgtcgaggacggggagatccgc
atcaatgtgggcggcttcaagaggaggctgcgctcgcacacgctgctgcgcttccccgag
acgcgcctgggccgcttgctgctctgccactcgcgcgaggccattctggagctctgcgat
gactacgacgacgtccagcgggagttctacttcgaccgcaaccctgagctcttcccctac
gtgctgcatttctatcacaccggcaagcttcacgtcatggctgagctatgtgtcttctcc
ttcagccaggagatcgagtactggggcatcaacgagttcttcattgactcctgctgcagc
tacagctaccatggccgcaaagtagagcccgagcaggagaagtgggacgagcagagtgac
caggagagcaccacgtcttccttcgatgagatccttgccttctacaacgacgcctccaag
ttcgatgggcagcccctcggcaacttccgcaggcagctgtggctggcgctggacaacccc
ggctactcagtgctgagcagggtcttcagcatcctgtccatcctggtggtgatggggtcc
atcatcaccatgtgcctcaatagcctgcccgatttccaaatccctgacagccagggcaac
cctggcgaggaccctaggttcgaaatcgtggagcactttggcattgcctggttcacattt
gagctggtggccaggtttgctgtggcccctgacttcctcaagttcttcaagaatgcccta
aaccttattgacctcatgtccatcgtccccttttacatcactctggtggtgaacctggtg
gtggagagcacacctactttagccaacttgggcagggtggcccaggtcctgaggctgatg
cggatcttccgcatcttaaagctggccaggcactccactggcctccgctccctgggggcc
actttgaaatacagctacaaagaagtagggctgctcttgctctacctctccgtggggatt
tccatcttctccgtggtggcctacaccattgaaaaggaggagaacgagggcctggccacc
atccctgcctgctggtggtgggctaccgtcagtatgaccacagtggggtacggggatgtg
gtcccagggaccacggcaggaaagctgactgcctctgcctgcatcttggcaggcatcctc
gtggtggtcctgcccatcaccttgatcttcaataagttctcccacttttaccggcgccaa
aagcaacttgagagtgccatgcgcagctgtgactttggagatggaatgaaggaggtccct
tcggtcaatttaagggactattatgcccataaagttaaatcccttatggcaagcctgacg
aacatgagcaggagctcaccaagtgaactcagtttaaatgattccctacgttag

DBGET integrated database retrieval system