KEGG   Homo sapiens (human): 3798Help
Entry
3798              CDS       T01001                                 

Gene name
KIF5A, D12S1889, MY050, NEIMY, NKHC, SPG10
Definition
(RefSeq) kinesin family member 5A
  KO
K10396  
kinesin family member 5
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Dopaminergic synapse
Disease
H00266  
Hereditary spastic paraplegia (SPG)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3798 (KIF5A)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    3798 (KIF5A)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    3798 (KIF5A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3798 (KIF5A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3798 (KIF5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q12840(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 1032 aa AA seqDB search
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
ATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQETAAS
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaccaacaacgaatgtagcatcaaggtgctctgccgattccggcccctgaac
caggctgagattctgcggggagacaagttcatccccattttccaaggggacgacagcgtc
gttattggggggaagccatatgtttttgaccgtgtattccccccaaacacgactcaagag
caagtttatcatgcatgtgccatgcagattgtcaaagatgtccttgctggctacaatggc
accatttttgcttatggacagacatcctcagggaaaacacataccatggagggaaagctg
cacgaccctcagctgatgggaatcattcctcgaattgcccgagacatcttcaaccacatc
tactccatggatgagaaccttgagttccacatcaaggtttcttactttgaaatttacctg
gacaaaattcgtgaccttctggatgtgaccaagacaaatctgtccgtgcacgaggacaag
aaccgggtgccatttgtcaagggttgtactgaacgctttgtgtccagcccggaggagatt
ctggatgtgattgatgaagggaaatcaaatcgtcatgtggctgtcaccaacatgaatgaa
cacagctctcggagccacagcatcttcctcatcaacatcaagcaggagaacatggaaacg
gagcagaagctcagtgggaagctgtatctggtggacctggcagggagtgagaaggtcagc
aagactggagcagagggagccgtgctggacgaggcaaagaatatcaacaagtcactgtca
gctctgggcaatgtgatctccgcactggctgagggcactaaaagctatgttccatatcgt
gacagcaaaatgacaaggattctccaggactctctcgggggaaactgccggacgactatg
ttcatctgttgctcaccatccagttataatgatgcagagaccaagtccaccctgatgttt
gggcagcgggcaaagaccattaagaacactgcctcagtaaatttggagttgactgctgag
cagtggaagaagaaatatgagaaggagaaggagaagacaaaggcccagaaggagacgatt
gcgaagctggaggctgagctgagccggtggcgcaatggagagaatgtgcctgagacagag
cgcctggctggggaggaggcagccctgggagccgagctctgtgaggagacccctgtgaat
gacaactcatccatcgtggtgcgcatcgcgcccgaggagcggcagaaatacgaggaggag
atccgccgtctctataagcagcttgacgacaaggatgatgaaatcaaccaacaaagccaa
ctcatagagaagctcaagcagcaaatgctggaccaggaagagctgctggtgtccacccga
ggagacaacgagaaggtccagcgggagctgagccacctgcaatcagagaacgatgccgct
aaggatgaggtgaaggaagtgctgcaggccctggaggagctggctgtgaactatgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagcttctggtggatgagctgtct
cagaaggtggccaccatgctgtccctggagtctgagttgcagcggctacaggaggtcagt
ggacaccagcgaaaacgaattgctgaggtgctgaacgggctgatgaaggatctgagcgag
ttcagtgtcattgtgggcaacggggagattaagctgccagtggagatcagtggggccatc
gaggaggagttcactgtggcccgactctacatcagcaaaatcaaatcagaagtcaagtct
gtggtcaagcggtgccggcagctggagaacctccaggtggagtgtcaccgcaagatggaa
gtgaccgggcgggagctctcatcctgccagctcctcatctctcagcatgaggccaagatc
cgctcgcttacggaatacatgcagagcgtggagctaaagaagcggcacctggaagagtcc
tatgactccttgagcgatgagctggccaagctccaggcccaggaaactgtgcatgaagtg
gccctgaaggacaaggagcctgacactcaggatgcagatgaagtgaagaaggctctggag
ctgcagatggagagtcaccgggaggcccatcaccggcagctggcccggctccgggacgag
atcaacgagaagcagaagaccattgatgagctcaaagacctaaatcagaagctccagtta
gagctagagaagcttcaggctgactacgagaagctgaagagcgaagaacacgagaagagc
accaagctgcaggagctgacatttctgtacgagcgacatgagcagtccaagcaggacctc
aagggtctggaggagacagttgcccgggaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaagacagt
ggggggattcactcccaaaagcagaagatttcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttagggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgccatgaaggacaagcgccggtaccagcaggaggtggaccgcatc
aaggaggccgttcgctacaagagctcgggcaaacggggccattctgcccagattgccaaa
cccgtccggcctggccactacccagcatcctcacccaccaacccctatggcacccggagc
cctgagtgcatcagttacaccaacagcctcttccagaactaccagaatctctacctgcag
gccacacccagctccacctcagatatgtactttgcaaactcctgtaccagcagtggagcc
acatcttctggcggccccttggcttcctaccagaaggccaacatggacaatggaaatgcc
acagatatcaatgacaataggagtgacctgccgtgtggctatgaggctgaggaccaggcc
aagcttttccctctccaccaagagacagcagccagctaa

DBGET integrated database retrieval system