KEGG   Homo sapiens (human): 3802Help
Entry
3802              CDS       T01001                                 

Gene name
KIR2DL1, CD158A, KIR-K64, KIR221, NKAT, NKAT-1, NKAT1, p58.1
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1
  KO
K07981  
killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
Cellular senescence
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    3802 (KIR2DL1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3802 (KIR2DL1)
   04612 Antigen processing and presentation
    3802 (KIR2DL1)
 Human Diseases
  Immune diseases
   05332 Graft-versus-host disease
    3802 (KIR2DL1)
CD molecules [BR:hsa04090]
 Proteins
  3802 (KIR2DL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P43626(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.42
AA seq 348 aa AA seqDB search
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDI
VIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGT
FQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcttggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcagtgttggtcagatgtcatgtttgaacacttccttctg
cacagagaggggatgtttaacgacactttgcgcctcattggagaacaccatgatggggtc
tccaaggccaacttctccatcagtcgcatgacgcaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcaggtgtcagctcccagtgaccctctggacatc
gtgatcataggtctatatgagaaaccttctctctcagcccagctgggccccacggttctg
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggcccaaggtcaacggaaca
ttccaggctgactttcctctgggccctgccacccacggagggacctacagatgcttcggc
tctttccatgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcaggaaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

DBGET integrated database retrieval system