KEGG   Homo sapiens (human): 3802Help
Entry
3802              CDS       T01001                                 

Gene name
KIR2DL1, CD158A, KIR-K64, KIR221, NKAT, NKAT1, p58.1
Definition
killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1
Orthology
K07981  
killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Drug target
Other: 
Class
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:hsa05332]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.4
AA seq 348 aa AA seqDB search
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDI
VIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGT
FQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcttggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcagtgttggtcagatgtcatgtttgaacacttccttctg
cacagagaggggatgtttaacgacactttgcgcctcattggagaacaccatgatggggtc
tccaaggccaacttctccatcagtcgcatgacgcaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcaggtgtcagctcccagtgaccctctggacatc
gtgatcataggtctatatgagaaaccttctctctcagcccagctgggccccacggttctg
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggcccaaggtcaacggaaca
ttccaggctgactttcctctgggccctgccacccacggagggacctacagatgcttcggc
tctttccatgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcaggaaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

DBGET integrated database retrieval system