KEGG   Homo sapiens (human): 3803Help
Entry
3803              CDS       T01001                                 

Gene name
KIR2DL2, CD158B1, CD158b, NKAT-6, NKAT6, p58.2
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 2
  KO
K07981  
killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Drug target
Lirilumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3803 (KIR2DL2)
   04612 Antigen processing and presentation
    3803 (KIR2DL2)
 Human Diseases
  Immune diseases
   05332 Graft-versus-host disease
    3803 (KIR2DL2)
Cellular antigens [BR:hsa04090]
 Proteins
  3803 (KIR2DL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Pharos: 
P43627(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.4
AA seq 348 aa AA seqDB search
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttgagcacttccttctg
cacagagaagggaagtttaaggacactttgcacctcattggagagcaccatgatggggtc
tccaaagccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaatgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctctaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcagggaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

DBGET integrated database retrieval system