KEGG   Homo sapiens (human): 3804Help
Entry
3804              CDS       T01001                                 

Gene name
KIR2DL3, CD158B2, CD158b, GL183, KIR-023GB, KIR-K7b, KIR-K7c, KIR2DS5, KIRCL23, NKAT, NKAT2, NKAT2A, NKAT2B, p58
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3
  KO
K07981  
killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
Cellular senescence
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    3804 (KIR2DL3)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3804 (KIR2DL3)
   04612 Antigen processing and presentation
    3804 (KIR2DL3)
 Human Diseases
  Immune diseases
   05332 Graft-versus-host disease
    3804 (KIR2DL3)
CD molecules [BR:hsa04090]
 Proteins
  3804 (KIR2DL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P43628(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.42
AA seq 341 aa AA seqDB search
MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDPQE
VTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggtgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcccctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttcagcacttccttctg
cacagagaagggaagtttaaggacactttgcacctcattggagagcaccatgatggggtc
tccaaggccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaacgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctgcatgttctgattgggacctcagtggtcatcatcctcttcatcctcctc
ctcttctttctccttcatcgctggtgctgcaacaaaaaaaatgctgttgtaatggaccaa
gagcctgcagggaacagaacagtgaacagggaggactctgatgaacaagaccctcaggag
gtgacatatgcacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttct
cagaggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgag
ccctga

DBGET integrated database retrieval system