KEGG   Homo sapiens (human): 3804Help
Entry
3804              CDS       T01001                                 

Gene name
KIR2DL3, CD158B2, CD158b, GL183, KIR-023GB, KIR-K7b, KIR-K7c, KIR2DS5, KIRCL23, NKAT, NKAT2, NKAT2A, NKAT2B, p58
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3
  KO
K07981  
killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Drug target
Lirilumab: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3804 (KIR2DL3)
   04612 Antigen processing and presentation
    3804 (KIR2DL3)
 Human Diseases
  Immune diseases
   05332 Graft-versus-host disease
    3804 (KIR2DL3)
Cellular antigens [BR:hsa04090]
 Proteins
  3804 (KIR2DL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P43628(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.42
AA seq 341 aa AA seqDB search
MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDPQE
VTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggtgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcccctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttcagcacttccttctg
cacagagaagggaagtttaaggacactttgcacctcattggagagcaccatgatggggtc
tccaaggccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaacgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctgcatgttctgattgggacctcagtggtcatcatcctcttcatcctcctc
ctcttctttctccttcatcgctggtgctgcaacaaaaaaaatgctgttgtaatggaccaa
gagcctgcagggaacagaacagtgaacagggaggactctgatgaacaagaccctcaggag
gtgacatatgcacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttct
cagaggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgag
ccctga

DBGET integrated database retrieval system