KEGG   Homo sapiens (human): 3806Help
Entry
3806              CDS       T01001                                 

Gene name
KIR2DS1, CD158H, CD158a, p50.1
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1
  KO
K07982  
killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3806 (KIR2DS1)
   04612 Antigen processing and presentation
    3806 (KIR2DS1)
Cellular antigens [BR:hsa04090]
 Proteins
  3806 (KIR2DS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Pharos: 
Q14954(Tdark)
UniProt: 
Position
19q13.4
AA seq 304 aa AA seqDB search
MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGT
FQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcacggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcatgtttgaacacttccttctg
cacagagaggggatgtttaacgacactttgcgcctcattggagaacaccatgatggggtc
tccaaggccaacttctccatcagtcgcatgaagcaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtgatcataggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggaccaaggtcaacggaaca
ttccaggccaactttcctctgggccctgccacccatggagggacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctacatgttctgattgggacctcagtggtcaaaatccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccgacaaaaaaaatgctgctgtaatggaccaa
gagcctgcagggaacagaacagtgaacagcgaggattctgatgaacaagaccatcaggag
gtgtcatacgcataa

DBGET integrated database retrieval system