KEGG   Homo sapiens (human): 381Help
Entry
381               CDS       T01001                                 

Gene name
ARF5
Definition
(RefSeq) ADP ribosylation factor 5
  KO
K07940  
ADP-ribosylation factor 5
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    381 (ARF5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   381 (ARF5)
  Exosomal proteins of colorectal cancer cells
   381 (ARF5)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    381 (ARF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31.3
AA seq 180 aa AA seqDB search
MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAV
LLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcaccgtgtccgcgctcttttcgcggatcttcgggaagaagcagatgcggatt
ctcatggttggcttggatgcggctggcaagaccacaatcctgtacaaactgaagttgggg
gagattgtcaccaccatcccaaccataggcttcaatgtagaaacagtggaatataagaac
atctgtttcacagtctgggacgtgggaggccaggacaagattcggcctctgtggcggcac
tacttccagaacactcagggcctcatctttgtggtggacagtaatgaccgggagcgggtc
caagaatctgctgatgaactccagaagatgctgcaggaggacgagctgcgggatgcagtg
ctgctggtatttgccaacaagcaggacatgcccaacgccatgcccgtgagcgagctgact
gacaagctggggctacagcacttacgcagccgcacgtggtatgtccaggccacctgtgcc
acccaaggcacaggtctgtacgatggtctggactggctgtcccacgagctgtcaaagcgc
taa

DBGET integrated database retrieval system