KEGG   Homo sapiens (human): 3811Help
Entry
3811              CDS       T01001                                 

Gene name
KIR3DL1, CD158E1, KIR, KIR3DL1/S1, NKAT-3, NKAT3, NKB1, NKB1B
Definition
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 1
  KO
K07980  
killer cell immunoglobulin-like receptor 3DL
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3811 (KIR3DL1)
   04612 Antigen processing and presentation
    3811 (KIR3DL1)
 Human Diseases
  Immune diseases
   05332 Graft-versus-host disease
    3811 (KIR3DL1)
Cellular antigens [BR:hsa04090]
 Proteins
  3811 (KIR3DL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P43629(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.42
AA seq 444 aa AA seqDB search
MLLMVVSMACVGFFLVQRAGPHVGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFML
YKEDRIHVPIFHGRLFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGN
HRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANF
SIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHS
PYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLL
HLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKT
PPTDTILYTELPNAKPRSKVVSCP
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcatggtcgtcagcatggcgtgtgttgggttcttcttggtccagagggccggt
ccacacgtgggtggtcaggacaagcccttcctgtctgcctggcccagcgctgtggtgcct
cgaggaggacacgtgactcttcggtgtcactatcgtcataggtttaacaatttcatgcta
tacaaagaagacagaatccacgttcccatcttccatggcagattattccaggagagcttc
aacatgagccctgtgaccacagcacatgcagggaactacacatgtcggggttcacaccca
cactcccccactgggtggtcggcacccagcaaccccgtggtgatcatggtcacaggaaac
cacagaaaaccttccctcctggcccacccaggtcccctggtgaaatcaggagagagagtc
atcctgcaatgttggtcagatatcatgtttgagcacttctttctgcacaaagaggggatc
tctaaggacccctcacgcctcgttggacagatccatgatggggtctccaaggccaatttc
tccatcggtcccatgatgcttgcccttgcagggacctacagatgctacggttctgttact
cacaccccctatcagttgtcagctcccagtgatcccctggacatcgtggtcacaggtcca
tatgagaaaccttctctctcagcccagccgggccccaaggttcaggcaggagagagcgtg
accttgtcctgcagctcccggagctcctatgacatgtaccatctatccagggagggggga
gcccatgaacgtaggctccctgcagtgcgcaaggtcaacagaacattccaggcagatttc
cctctgggccctgccacccacggagggacctacagatgcttcggctctttccgtcactct
ccctacgagtggtcagacccgagtgacccactgcttgtttctgtcacaggaaacccttca
agtagttggccttcacccacagaaccaagctccaaatctggtaaccccagacacctgcac
attctgattgggacctcagtggtcatcatcctcttcatcctcctcctcttctttctcctt
catctctggtgctccaacaaaaaaaatgctgctgtaatggaccaagagcctgcagggaac
agaacagccaacagcgaggactctgatgaacaagaccctgaggaggtgacatacgcacag
ttggatcactgcgttttcacacagagaaaaatcactcgcccttctcagaggcccaagaca
ccccctacagataccatcttgtacacggaacttccaaatgctaagcccagatccaaagtt
gtctcctgcccatga

DBGET integrated database retrieval system