KEGG   Homo sapiens (human): 3812Help
Entry
3812              CDS       T01001                                 

Gene name
KIR3DL2, CD158K, NKAT-4, NKAT4, NKAT4B, p140
Definition
killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2
Orthology
K07980  
killer cell immunoglobulin-like receptor 3DL
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3812 (KIR3DL2)
   04612 Antigen processing and presentation
    3812 (KIR3DL2)
 Human Diseases
  Immune diseases
   05332 Graft-versus-host disease
    3812 (KIR3DL2)
Cellular antigens [BR:hsa04090]
 Proteins
  3812 (KIR3DL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.4
AA seq 438 aa AA seqDB search
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFML
YKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGN
HRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANF
SIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRAL
PCVWSNSSDPLLVSVTGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEP
AGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPR
SKVVSCPRAPQSGLEGVF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcacggtcgtcagcatggcgtgcgttgggttcttcttgctgcagggggcctgg
ccactcatgggtggtcaggacaaacccttcctgtctgcccggcccagcactgtggtgcct
cgaggaggacacgtggctcttcagtgtcactatcgtcgtgggtttaacaatttcatgctg
tacaaagaagacagaagccacgttcccatcttccacggcagaatattccaggagagcttc
atcatgggccctgtgaccccagcacatgcagggacctacagatgtcggggttcacgccca
cactccctcactgggtggtcggcacccagcaaccccctggtgatcatggtcacaggaaac
cacagaaaaccttccctcctggcccacccagggcccctgctgaaatcaggagagacagtc
atcctgcaatgttggtcagatgtcatgtttgagcacttctttctgcacagagaggggatc
tctgaggacccctcacgcctcgttggacagatccatgatggggtctccaaggccaacttc
tccatcggtcccttgatgcctgtccttgcaggaacctacagatgttatggttctgttcct
cactccccctatcagttgtcagctcccagtgaccccctggacatcgtgatcacaggtcta
tatgagaaaccttctctctcagcccagccgggccccacggttcaggcaggagagaacgtg
accttgtcctgtagctcctggagctcctatgacatctaccatctgtccagggaaggggag
gcccatgaacgtaggctccgtgcagtgcccaaggtcaacagaacattccaggcagacttt
cctctgggccctgccacccacggagggacctacagatgcttcggctctttccgtgccctg
ccctgcgtgtggtcaaactcaagtgacccactgcttgtttctgtcacaggtatctgcaga
cacctgcatgttctgattgggacctcagtggtcatcttcctcttcatcctcctcctcttc
tttctcctttatcgctggtgctccaacaaaaagaatgctgctgtaatggaccaagagcct
gcgggggacagaacagtgaataggcaggactctgatgaacaagaccctcaggaggtgacg
tacgcacagttggatcactgcgttttcatacagagaaaaatcagtcgcccttctcagagg
cccaagacacccctaacagataccagcgtgtacacggaacttccaaatgctgagcccaga
tccaaagttgtctcctgcccacgagcaccacagtcaggtcttgagggggttttctag

DBGET integrated database retrieval system