KEGG   Homo sapiens (human): 3812Help
Entry
3812              CDS       T01001                                 

Gene name
KIR3DL2, 3DL2, CD158K, KIR-3DL2, NKAT-4, NKAT4, NKAT4B, p140
Definition
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3812 (KIR3DL2)
   04612 Antigen processing and presentation
    3812 (KIR3DL2)
 Human Diseases
  Immune diseases
   05332 Graft-versus-host disease
    3812 (KIR3DL2)
CD molecules [BR:hsa04090]
 Proteins
  3812 (KIR3DL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_2 Ig_3 MAP17
Motif
Other DBs
NCBI-GeneID: 3812
NCBI-ProteinID: NP_006728
OMIM: 604947
HGNC: 6339
Ensembl: ENSG00000240403
Vega: OTTHUMG00000065935
Pharos: P43630(Tbio)
UniProt: P43630 A0A0U1WNF3 Q8NHK6
Position
19q13.42
AA seq 455 aa AA seqDB search
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFML
YKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGN
HRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANF
SIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRAL
PCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLL
YRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKT
PLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcacggtcgtcagcatggcgtgcgttgggttcttcttgctgcagggggcctgg
ccactcatgggtggtcaggacaaacccttcctgtctgcccggcccagcactgtggtgcct
cgaggaggacacgtggctcttcagtgtcactatcgtcgtgggtttaacaatttcatgctg
tacaaagaagacagaagccacgttcccatcttccacggcagaatattccaggagagcttc
atcatgggccctgtgaccccagcacatgcagggacctacagatgtcggggttcacgccca
cactccctcactgggtggtcggcacccagcaaccccctggtgatcatggtcacaggaaac
cacagaaaaccttccctcctggcccacccagggcccctgctgaaatcaggagagacagtc
atcctgcaatgttggtcagatgtcatgtttgagcacttctttctgcacagagaggggatc
tctgaggacccctcacgcctcgttggacagatccatgatggggtctccaaggccaacttc
tccatcggtcccttgatgcctgtccttgcaggaacctacagatgttatggttctgttcct
cactccccctatcagttgtcagctcccagtgaccccctggacatcgtgatcacaggtcta
tatgagaaaccttctctctcagcccagccgggccccacggttcaggcaggagagaacgtg
accttgtcctgtagctcctggagctcctatgacatctaccatctgtccagggaaggggag
gcccatgaacgtaggctccgtgcagtgcccaaggtcaacagaacattccaggcagacttt
cctctgggccctgccacccacggagggacctacagatgcttcggctctttccgtgccctg
ccctgcgtgtggtcaaactcaagtgacccactgcttgtttctgtcacaggaaacccttca
agtagttggccttcacccacagaaccaagctccaaatctggtatctgcagacacctgcat
gttctgattgggacctcagtggtcatcttcctcttcatcctcctcctcttctttctcctt
tatcgctggtgctccaacaaaaagaatgctgctgtaatggaccaagagcctgcgggggac
agaacagtgaataggcaggactctgatgaacaagaccctcaggaggtgacgtacgcacag
ttggatcactgcgttttcatacagagaaaaatcagtcgcccttctcagaggcccaagaca
cccctaacagataccagcgtgtacacggaacttccaaatgctgagcccagatccaaagtt
gtctcctgcccacgagcaccacagtcaggtcttgagggggttttctag

DBGET integrated database retrieval system