KEGG   Homo sapiens (human): 3820Help
Entry
3820              CDS       T01001                                 

Gene name
KLRB1, CD161, CLEC5B, NKR, NKR-P1, NKR-P1A, NKRP1A, hNKR-P1A
Definition
killer cell lectin-like receptor subfamily B, member 1
Orthology
K06543  
killer cell lectin-like receptor subfamily B
Organism
hsa  Homo sapiens (human)
Pathway
Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05144 Malaria
    3820 (KLRB1)
Cellular antigens [BR:hsa04090]
 Proteins
  3820 (KLRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
12p13
AA seq 225 aa AA seqDB search
MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSV
SVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLA
DCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEI
RGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacaagcaatatatgctgagttaaacttacccacagactcaggcccagaaagt
tcttcaccttcatctcttcctcgggatgtctgtcagggttcaccttggcatcaatttgcc
ctgaaacttagctgtgctgggattattctccttgtcttggttgttactgggttgagtgtt
tcagtgacatccttaatacagaaatcatcaatagaaaaatgcagtgtggacattcaacag
agcaggaataaaacaacagagagaccgggtctcttaaactgcccaatatattggcagcaa
ctccgagagaaatgcttgttattttctcacactgtcaacccttggaataacagtctagct
gattgttccaccaaagaatccagcctgctgcttattcgagataaggatgaattgatacac
acacagaacctgatacgtgacaaagcaattctgttttggattggattaaatttttcatta
tcagaaaagaactggaagtggataaacggctcttttttaaattctaatgacttagaaatt
agaggtgatgctaaagaaaacagctgtatttccatctcacagacatctgtgtattctgag
tactgtagtacagaaatcagatggatctgccaaaaagaactaacacctgtgagaaataaa
gtgtatcctgactcttga

DBGET integrated database retrieval system