KEGG   Homo sapiens (human): 3821Help
Entry
3821              CDS       T01001                                 

Gene name
KLRC1, CD159A, NKG2, NKG2A
Definition
killer cell lectin-like receptor subfamily C, member 1
Orthology
K06541  
killer cell lectin-like receptor subfamily C
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3821 (KLRC1)
   04612 Antigen processing and presentation
    3821 (KLRC1)
 Human Diseases
  Immune diseases
   05332 Graft-versus-host disease
    3821 (KLRC1)
Cellular antigens [BR:hsa04090]
 Proteins
  3821 (KLRC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 233 aa AA seqDB search
MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYH
CKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCP
EEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRN
SSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggataaccaaggagtaatctactcagacctgaatctgcccccaaacccaaagaggcag
caacgaaaacctaaaggcaataaaagctccattttagcaactgaacaggaaataacctat
gcggaattaaaccttcaaaaagcttctcaggattttcaagggaatgacaaaacctatcac
tgcaaagatttaccatcagctccagagaagctcattgttgggatcctgggaattatctgt
cttatcttaatggcctctgtggtaacgatagttgttattccctctacattaatacagagg
cacaacaattcttccctgaatacaagaactcagaaagcacgtcattgtggccattgtcct
gaggagtggattacatattccaacagttgttactacattggtaaggaaagaagaacttgg
gaagagagtttgctggcctgtacttcgaagaactccagtctgctttctatagataatgaa
gaagaaatgaaatttctgtccatcatttcaccatcctcatggattggtgtgtttcgtaac
agcagtcatcatccatgggtgacaatgaatggtttggctttcaaacatgagataaaagac
tcagataatgctgaacttaactgtgcagtgctacaagtaaatcgacttaaatcagcccag
tgtggatcttcaataatatatcattgtaagcataagctttag

DBGET integrated database retrieval system