KEGG   Homo sapiens (human): 3827Help
Entry
3827              CDS       T01001                                 

Gene name
KNG1, BDK, BK, KNG
Definition
kininogen 1
Orthology
K03898  
kininogen
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3q27
AA seq 427 aa AA seqDB search
MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT
EATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFS
VATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLN
EVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLR
IASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
IDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPW
EKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTSHLRSCEYKGRPPKAGAEP
ASEREVS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaattaccatccttttcctctgctccaggctgctactaagtttaacccaggaa
tcacagtccgaggaaattgactgcaatgacaaggatttatttaaagctgtggatgctgct
ctgaagaaatataacagtcaaaaccaaagtaacaaccagtttgtattgtaccgcataact
gaagccactaagacggttggctctgacacgttttattccttcaagtacgaaatcaaggag
ggggattgtcctgttcaaagtggcaaaacctggcaggactgtgagtacaaggatgctgca
aaagcagccactggagaatgcacggcaaccgtggggaagaggagcagtacgaaattctcc
gtggctacccagacctgccagattactccagccgagggccctgtggtgacagcccagtac
gactgcctcggctgtgtgcatcctatatcaacgcagagcccagacctggagcccattctg
agacacggcattcagtactttaacaacaacactcaacattcctccctcttcatgcttaat
gaagtaaaacgggcccaaagacaggtggtggctggattgaactttcgaattacctactca
attgtgcaaacgaattgttccaaagagaattttctgttcttaactccagactgcaagtcc
ctttggaatggtgataccggtgaatgtacagataatgcatacatcgatattcagctacga
attgcttccttctcacagaactgtgacatttatccagggaaggattttgtacaaccacct
accaagatttgcgtgggctgccccagagatatacccaccaacagcccagagctggaggag
acactgactcacaccatcacaaagcttaatgcagagaataacgcaactttctatttcaag
attgacaatgtgaaaaaagcaagagtacaggtggtggctggcaagaaatattttattgac
ttcgtggccagggaaaccacatgttccaaggaaagtaatgaagagttgaccgaaagctgt
gagaccaaaaaacttggccaaagcctagattgcaacgctgaagtttatgtggtaccctgg
gagaaaaaaatttaccctactgtcaactgtcaaccactgggaatgatctcactgatgaaa
aggcctccaggtttttcacctttccgatcatcacgaataggggaaataaaagaagaaaca
actagtcacctaaggtcctgcgagtacaagggtcgacccccaaaggcaggggcagagcca
gcatctgagagggaggtctcttga

DBGET integrated database retrieval system