KEGG   Homo sapiens (human): 383Help
Entry
383               CDS       T01001                                 

Gene name
ARG1
Definition
arginase 1 (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Disease
H00186  
Hyperargininemia
H01398  
Primary hyperammonemic disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    383 (ARG1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    383 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    383 (ARG1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     383 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q23
AA seq 322 aa AA seqDB search
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN
DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LACFGLAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaagtccagaaccatagggattattggagctcctttctcaaagggacagcca
cgaggaggggtggaagaaggccctacagtattgagaaaggctggtctgcttgagaaactt
aaagaacaagagtgtgatgtgaaggattatggggacctgccctttgctgacatccctaat
gacagtccctttcaaattgtgaagaatccaaggtctgtgggaaaagcaagcgagcagctg
gctggcaaggtggcagaagtcaagaagaacggaagaatcagcctggtgctgggcggagac
cacagtttggcaattggaagcatctctggccatgccagggtccaccctgatcttggagtc
atctgggtggatgctcacactgatatcaacactccactgacaaccacaagtggaaacttg
catggacaacctgtatctttcctcctgaaggaactaaaaggaaagattcccgatgtgcca
ggattctcctgggtgactccctgtatatctgccaaggatattgtgtatattggcttgaga
gacgtggaccctggggaacactacattttgaaaactctaggcattaaatacttttcaatg
actgaagtggacagactaggaattggcaaggtgatggaagaaacactcagctatctacta
ggaagaaagaaaaggccaattcatctaagttttgatgttgacggactggacccatctttc
acaccagctactggcacaccagtcgtgggaggtctgacatacagagaaggtctctacatc
acagaagaaatctacaaaacagggctactctcaggattagatataatggaagtgaaccca
tccctggggaagacaccagaagaagtaactcgaacagtgaacacagcagttgcaataacc
ttggcttgtttcggacttgctcgggagggtaatcacaagcctattgactaccttaaccca
cctaagtaa

DBGET integrated database retrieval system