KEGG   Homo sapiens (human): 383Help
Entry
383               CDS       T01001                                 

Gene name
ARG1
Definition
arginase 1 (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Disease
H00186  
Hyperargininemia
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q23
AA seq 322 aa AA seqDB search
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN
DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LACFGLAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaagtccagaaccatagggattattggagctcctttctcaaagggacagcca
cgaggaggggtggaagaaggccctacagtattgagaaaggctggtctgcttgagaaactt
aaagaacaagagtgtgatgtgaaggattatggggacctgccctttgctgacatccctaat
gacagtccctttcaaattgtgaagaatccaaggtctgtgggaaaagcaagcgagcagctg
gctggcaaggtggcagaagtcaagaagaacggaagaatcagcctggtgctgggcggagac
cacagtttggcaattggaagcatctctggccatgccagggtccaccctgatcttggagtc
atctgggtggatgctcacactgatatcaacactccactgacaaccacaagtggaaacttg
catggacaacctgtatctttcctcctgaaggaactaaaaggaaagattcccgatgtgcca
ggattctcctgggtgactccctgtatatctgccaaggatattgtgtatattggcttgaga
gacgtggaccctggggaacactacattttgaaaactctaggcattaaatacttttcaatg
actgaagtggacagactaggaattggcaaggtgatggaagaaacactcagctatctacta
ggaagaaagaaaaggccaattcatctaagttttgatgttgacggactggacccatctttc
acaccagctactggcacaccagtcgtgggaggtctgacatacagagaaggtctctacatc
acagaagaaatctacaaaacagggctactctcaggattagatataatggaagtgaaccca
tccctggggaagacaccagaagaagtaactcgaacagtgaacacagcagttgcaataacc
ttggcttgtttcggacttgctcgggagggtaatcacaagcctattgactaccttaaccca
cctaagtaa

DBGET integrated database retrieval system