KEGG   Homo sapiens (human): 3831Help
Entry
3831              CDS       T01001                                 

Gene name
KLC1, KLC, KNS2, KNS2A
Definition
(RefSeq) kinesin light chain 1
  KO
K10407  
kinesin light chain
Organism
hsa  Homo sapiens (human)
Pathway
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    3831 (KLC1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     3831 (KLC1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3831 (KLC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q07866(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.33
AA seq 573 aa AA seqDB search
MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLF
PNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGE
EVSMSVEWNGGVSGRASFCGKRQQQQWPGRRHR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacaacatgtccacaatggtgtacataaaggaagacaagttggagaagcttaca
caggatgaaattatttctaagacaaagcaagtaattcaggggctggaagctttgaagaat
gagcacaattccattttacaaagtttgctggagacactgaagtgtttgaagaaagatgat
gaaagtaatttggtggaggagaaatcaaacatgatccggaagtcactggagatgttggag
ctcggcctgagtgaggcacaggttatgatggctttgtcaaatcacctgaatgctgtggag
tccgagaagcagaaactgcgtgcgcaggttcgtcgtctgtgccaggagaatcagtggcta
cgggatgaactggccaacacgcagcagaaactgcagaagagtgagcagtctgtggctcaa
ctggaggaggagaagaagcatctggagtttatgaatcagctaaaaaaatatgatgacgac
atttccccatccgaggacaaagacactgattctaccaaagagcctctggatgaccttttc
cccaatgatgaagacgacccagggcaaggaatccagcagcagcacagcagtgcagccgcg
gctgcccagcagggcggctacgagatccccgcgcggctgcggacgctccacaacctggtg
atccagtacgcctcgcaggggcgctacgaggtagctgtgcccctctgcaagcaggccctg
gaggacctggagaagacttcaggacacgaccacccggacgtggccaccatgctcaacatc
ctggccttggtgtacagggatcagaataaatacaaagatgcagctaacctactgaatgat
gccttggctattcgtgagaaaactttgggcaaagatcatcctgcggtggcggcgactttg
aataaccttgcagtcctttatggtaaaagagggaagtacaaagaagcagagccgttgtgt
aaaagagctctggaaatccgagaaaaggttttggggaaggatcaccccgatgttgccaag
cagttaaataacttggccttactgtgccagaaccagggcaagtatgaagaagtagaatat
tattatcaaagagccctcgagatctaccagacaaaactgggacctgatgaccccaacgtg
gctaagacgaaaaataacctggcatcctgctatttgaaacaaggaaagttcaagcaagca
gaaacactgtacaaagagattctcactcgtgcacatgaaagggagtttggttctgtagat
gatgaaaataaacccatctggatgcatgctgaagaaagagaagaatgcaaaggaaagcaa
aaggatgggacatcttttggagagtatggcggctggtacaaagcctgcaaagttgatagt
ccaactgttacaaccactctaaaaaaccttggggcactttacagacgtcaaggcaaattt
gaagctgcagaaacgttagaagaagctgctatgaggtctcgtaaacagggtcttgacaat
gttcacaaacagagggtggcagaagtgctcaatgaccctgagaacatggagaagcgcagg
agccgtgagagcctcaacgtggacgtggtcaagtacgagagtggccctgacggaggggag
gaagtgagtatgagcgtagagtggaacgggggcgtctctggccgagcctctttttgtgga
aaacgacagcagcagcagtggcctggaagacgccaccgctaa

DBGET integrated database retrieval system