KEGG   Homo sapiens (human): 3832Help
Entry
3832              CDS       T01001                                 

Gene name
KIF11, EG5, HKSP, KNSL1, MCLMR, TRIP5
Definition
(RefSeq) kinesin family member 11
  KO
K10398  
kinesin family member 11
Organism
hsa  Homo sapiens (human)
Drug target
Ispinesib mesylate: 
Litronesib: 
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    3832 (KIF11)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     3832 (KIF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24.1
AA seq 1056 aa AA seqDB search
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY
ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS
LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV
SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT
SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ
ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS
QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE
TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM
MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK
DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcagccaaattcgtctgcgaagaagaaagaggagaaggggaagaacatccag
gtggtggtgagatgcagaccatttaatttggcagagcggaaagctagcgcccattcaata
gtagaatgtgatcctgtacgaaaagaagttagtgtacgaactggaggattggctgacaag
agctcaaggaaaacatacacttttgatatggtgtttggagcatctactaaacagattgat
gtttaccgaagtgttgtttgtccaattctggatgaagttattatgggctataattgcact
atctttgcgtatggccaaactggcactggaaaaacttttacaatggaaggtgaaaggtca
cctaatgaagagtatacctgggaagaggatcccttggctggtataattccacgtaccctt
catcaaatttttgagaaacttactgataatggtactgaattttcagtcaaagtgtctctg
ttggagatctataatgaagagctttttgatcttcttaatccatcatctgatgtttctgag
agactacagatgtttgatgatccccgtaacaagagaggagtgataattaaaggtttagaa
gaaattacagtacacaacaaggatgaagtctatcaaattttagaaaagggggcagcaaaa
aggacaactgcagctactctgatgaatgcatactctagtcgttcccactcagttttctct
gttacaatacatatgaaagaaactacgattgatggagaagagcttgttaaaatcggaaag
ttgaacttggttgatcttgcaggaagtgaaaacattggccgttctggagctgttgataag
agagctcgggaagctggaaatataaatcaatccctgttgactttgggaagggtcattact
gcccttgtagaaagaacacctcatgttccttatcgagaatctaaactaactagaatcctc
caggattctcttggagggcgtacaagaacatctataattgcaacaatttctcctgcatct
ctcaatcttgaggaaactctgagtacattggaatatgctcatagagcaaagaacatattg
aataagcctgaagtgaatcagaaactcaccaaaaaagctcttattaaggagtatacggag
gagatagaacgtttaaaacgagatcttgctgcagcccgtgagaaaaatggagtgtatatt
tctgaagaaaattttagagtcatgagtggaaaattaactgttcaagaagagcagattgta
gaattgattgaaaaaattggtgctgttgaggaggagctgaatagggttacagagttgttt
atggataataaaaatgaacttgaccagtgtaaatctgacctgcaaaataaaacacaagaa
cttgaaaccactcaaaaacatttgcaagaaactaaattacaacttgttaaagaagaatat
atcacatcagctttggaaagtactgaggagaaacttcatgatgctgccagcaagctgctt
aacacagttgaagaaactacaaaagatgtatctggtctccattccaaactggatcgtaag
aaggcagttgaccaacacaatgcagaagctcaggatatttttggcaaaaacctgaatagt
ctgtttaataatatggaagaattaattaaggatggcagctcaaagcaaaaggccatgcta
gaagtacataagaccttatttggtaatctgctgtcttccagtgtctctgcattagatacc
attactacagtagcacttggatctctcacatctattccagaaaatgtgtctactcatgtt
tctcagatttttaatatgatactaaaagaacaatcattagcagcagaaagtaaaactgta
ctacaggaattgattaatgtactcaagactgatcttctaagttcactggaaatgatttta
tccccaactgtggtgtctatactgaaaatcaatagtcaactaaagcatattttcaagact
tcattgacagtggccgataagatagaagatcaaaaaaaggaactagatggctttctcagt
atactgtgtaacaatctacatgaactacaagaaaataccatttgttccttggttgagtca
caaaagcaatgtggaaacctaactgaagacctgaagacaataaagcagacccattcccag
gaactttgcaagttaatgaatctttggacagagagattctgtgctttggaggaaaagtgt
gaaaatatacagaaaccacttagtagtgtccaggaaaatatacagcagaaatctaaggat
atagtcaacaaaatgacttttcacagtcaaaaattttgtgctgattctgatggcttctca
caggaactcagaaattttaaccaagaaggtacaaaattggttgaagaatctgtgaaacac
tctgataaactcaatggcaacctggaaaaaatatctcaagagactgaacagagatgtgaa
tctctgaacacaagaacagtttatttttctgaacagtgggtatcttccttaaatgaaagg
gaacaggaacttcacaacttattggaggttgtaagccaatgttgtgaggcttcaagttca
gacatcactgagaaatcagatggacgtaaggcagctcatgagaaacagcataacattttt
cttgatcagatgactattgatgaagataaattgatagcacaaaatctagaacttaatgaa
accataaaaattggtttgactaagcttaattgctttctggaacaggatctgaaactggat
atcccaacaggtacgacaccacagaggaaaagttatttatacccatcaacactggtaaga
actgaaccacgtgaacatctccttgatcagctgaaaaggaaacagcctgagctgttaatg
atgctaaactgttcagaaaacaacaaagaagagacaattccggatgtggatgtagaagag
gcagttctggggcagtatactgaagaacctctaagtcaagagccatctgtagatgctggt
gtggattgttcatcaattggcggggttccatttttccagcataaaaaatcacatggaaaa
gacaaagaaaacagaggcattaacacactggagaggtctaaagtggaagaaactacagag
cacttggttacaaagagcagattacctctgcgagcccagatcaacctttaa

DBGET integrated database retrieval system