KEGG   Homo sapiens (human): 3836Help
Entry
3836              CDS       T01001                                 

Gene name
KPNA1, IPOA5, NPI-1, RCH2, SRP1
Definition
(RefSeq) karyopherin subunit alpha 1
  KO
K15042  
importin subunit alpha-1
Organism
hsa  Homo sapiens (human)
Pathway
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05164 Influenza A
    3836 (KPNA1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    3836 (KPNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21
AA seq 538 aa AA seqDB search
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEE
VMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDE
VISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSS
EFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLC
RGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACW
TISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDK
IEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccaggaaaagagaactttcgcctgaaaagttacaagaacaaatctctgaat
cccgatgagatgcgcaggaggagggaggaagaaggactgcagttacgaaagcagaaaaga
gaagagcagttattcaagcggagaaatgttgctacagcagaagaagaaacagaagaagaa
gttatgtcagatggaggctttcatgaggctcagattagtaacatggagatggcaccaggt
ggtgtcatcacttctgacatgattgaaatgatattttccaaaagcccagagcaacagctt
tcagcaacacagaaattcaggaagctgctttcaaaagaacctaaccctcctattgatgaa
gttatcagcacaccaggagtagtggccaggtttgtggagttcctcaaacgaaaagagaat
tgtacactgcagtttgaatcagcttgggtactgacaaatattgcttcaggaaattctctt
cagacccgaattgtgattcaggcaggagctgtgcccatcttcatagagttgctcagctca
gagtttgaagatgtccaggaacaggcagtctgggctcttggcaacattgctggagatagt
accatgtgcagggactatgtcttagactgcaatatccttccccctcttttgcagttattt
tcaaagcaaaaccgcctgaccatgacccggaatgcagtatgggctttgtctaatctctgt
agagggaaaagtccacctccagaatttgcaaaggtttctccatgtctgaatgtgctttcc
tggttgctgtttgtcagtgacactgatgtactggctgatgcctgctgggccctctcatat
ctatcagatggacccaatgataaaattcaagcggtcatcgatgcgggagtatgtaggaga
cttgtggaactgctgatgcataatgattataaagtggtttctcctgctttgcgagctgtg
ggaaacattgtcacaggggatgatattcagacacaggtaattctgaattgctcagctctg
cagagtttattgcatttgctgagtagcccaaaggaatctatcaaaaaggaagcatgttgg
acgatatctaatattacagctggaaatagggcacagatccagactgtgatagatgccaac
attttcccagccctcattagtattttacaaactgctgaatttcggacaagaaaagaagca
gcttgggccatcacaaatgcaacttctggaggatcagctgaacagatcaagtacctagta
gaactgggttgtatcaagccgctctgtgatctcctcacggtcatggactctaagattgta
caggttgccctaaatggcttggaaaatatcctgaggcttggagaacaggaagccaaaagg
aatggcactggcattaacccttactgtgctttgattgaagaagcttatggtctggataaa
attgagttcttacagagtcatgaaaaccaggagatctaccaaaaggcctttgatcttatt
gagcattacttcgggaccgaagatgaagacagcagcattgcaccccaggttgaccttaac
cagcagcagtacatcttccaacagtgtgaggctcctatggaaggtttccagctttga

DBGET integrated database retrieval system