KEGG   Homo sapiens (human): 3837Help
Entry
3837              CDS       T01001                                 

Gene name
KPNB1, IMB1, IPO1, IPOB, Impnb, NTF97
Definition
karyopherin (importin) beta 1
Orthology
K14293  
importin subunit beta-1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    3837 (KPNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.32
AA seq 731 aa AA seqDB search
MKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFT
KANFDKESERHFIMQVVCEATQCPDTRVRVAALQNLVKIMSLYYQYMETYMGPALFAITI
EAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQYLVPI
LTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCEDDIVPHVLPFIKEHIKNPDWRYRDA
AVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAIN
DVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFEL
IVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQME
SHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLLRMFQSTAGSGGVQ
EDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNI
IPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDIALAIGGEFKKYLEVVLNTLQQASQA
QVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQENVHPDVMLVQPRVEFILSFIDHIA
GDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEARPMIHELLTEGRRSKTNKAKTLATWA
TKELRKLKNQA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagtcgacattggaagccatcggttatatttgccaagatatagacccagagcag
ctacaagataaatccaatgagattctgactgccataatccaggggatgaggaaagaagag
cctagtaataatgtgaagctagctgctacgaatgcactcctgaactcattggagttcacc
aaagcaaactttgataaagagtctgaaaggcactttattatgcaggtggtctgtgaagcc
acacagtgtccagatacgagggtacgagtggctgctttacagaatctggtgaagataatg
tccttatattatcagtacatggagacatatatgggtcctgctctttttgcaatcacaatc
gaagcaatgaaaagtgacattgatgaggtggctttacaagggatagaattctggtccaat
gtctgtgatgaggaaatggatttggccattgaagcttcagaggcagcagaacaaggacgg
ccccctgagcacaccagcaagttttatgcgaagggagcactacagtatctggttccaatc
ctcacacagacactaactaaacaggacgaaaatgatgatgacgatgactggaacccctgc
aaagcagcaggggtgtgcctcatgcttctggccacctgctgtgaagatgacattgtccca
catgtcctccccttcattaaagaacacatcaagaacccagattggcggtaccgggatgca
gcagtgatggcttttggttgtatcttggaaggaccagagcccagtcagctcaaaccacta
gttatacaggctatgcccaccctaatagaattaatgaaagaccccagtgtagttgttcga
gatacagctgcatggactgtaggcagaatttgtgagctgcttcctgaagctgccatcaat
gatgtctacttggctcccctgctacagtgtctgattgagggtctcagtgctgaacccaga
gtggcttcaaatgtgtgctgggctttctccagtctggctgaagctgcttatgaagctgca
gacgttgctgatgatcaggaagaaccagctacttactgcttatcttcttcatttgaactc
atagttcagaagctcctagagactacagacagacctgatggacaccagaacaacctgagg
agttctgcatatgaatctctgatggaaattgtgaaaaacagtgccaaggattgttatcct
gctgtccagaaaacgactttggtcatcatggaacgactgcaacaggttcttcagatggag
tcacatatccagagcacatccgatagaatccagttcaatgaccttcagtctttactctgt
gcaactcttcagaatgttcttcggaaagtgcaacatcaagatgctttgcagatctctgat
gtggttatggcctccctgttaaggatgttccaaagcacagctgggtctgggggagtacaa
gaggatgccctgatggcagttagcacactggtggaagtgttgggtggtgaattcctcaag
tacatggaggcctttaaacccttcctgggcattggattaaaaaattatgctgaataccag
gtttgtttggcagctgtgggcttagtgggagacttgtgccgtgccctgcaatccaacatc
atacctttctgtgacgaggtgatgcagctgcttctggaaaatttggggaatgagaacgtc
cacaggtctgtgaagccgcagattctgtcagtgtttggtgatattgcccttgctattgga
ggagagtttaaaaaatacttagaggttgtattgaatactcttcagcaggcctcccaagcc
caggtggacaagtcagactatgacatggtggattatctgaatgagctaagggaaagctgc
ttggaagcctatactggaatcgtccagggattaaagggggatcaggagaacgtacacccg
gatgtgatgctggtacaacccagagtagaatttattctgtctttcattgaccacattgct
ggagatgaggatcacacagatggagtagtagcttgtgctgctggactaataggggactta
tgtacagcatttgggaaggatgtactgaaattagtagaagctaggccaatgatccatgaa
ttgttaactgaagggcggagatcgaagactaacaaagcaaaaacccttgctacatgggca
acaaaagaactgaggaaactgaagaaccaagcttga

DBGET integrated database retrieval system