KEGG   Homo sapiens (human): 384Help
Entry
384               CDS       T01001                                 

Gene name
ARG2
Definition
arginase 2 (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.1
AA seq 354 aa AA seqDB search
MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctaaggggcagcctctcgcgtctcctccagacgcgagtgcattccatcctgaag
aaatccgtccactccgtggctgtgataggagccccgttctcacaagggcagaaaagaaaa
ggagtggagcatggtcccgctgccataagagaagctggcttgatgaaaaggctctccagt
ttgggctgccacctaaaagactttggagatttgagttttactccagtccccaaagatgat
ctctacaacaacctgatagtgaatccacgctcagtgggtcttgccaaccaggaactggct
gaggtggttagcagagctgtgtcagatggctacagctgtgtcacactgggaggagaccac
agcctggcaatcggtaccattagtggccatgcccgacactgcccagacctttgtgttgtc
tgggttgatgcccatgctgacatcaacacaccccttaccacttcatcaggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggataaggtaccacaactcccagga
ttttcctggatcaaaccttgtatctcttctgcaagtattgtgtatattggtctgagagac
gtggaccctcctgaacattttattttaaagaactatgatatccagtatttttccatgaga
gatattgatcgacttggtatccagaaggtcatggaacgaacatttgatctgctgattggc
aagagacaaagaccaatccatttgagttttgatattgatgcatttgaccctacactggct
ccagccacaggaactcctgttgtcgggggactaacctatcgagaaggcatgtatattgct
gaggaaatacacaatacagggttgctatcagcactggatcttgttgaagtcaatcctcag
ttggccacctcagaggaagaggcgaagactacagctaacctggcagtagatgtgattgct
tcaagctttggtcagacaagagaaggagggcatattgtctatgaccaacttcctactccc
agttcaccagatgaatcagaaaatcaagcacgtgtgagaatttag

DBGET integrated database retrieval system