KEGG   Homo sapiens (human): 3852Help
Entry
3852              CDS       T01001                                 

Gene name
KRT5, CK5, DDD, DDD1, EBS2, K5, KRT5A
Definition
keratin 5
Orthology
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00584  
Epidermolysis bullosa simplex
H00944  
Dowling-Degos disease
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 590 aa AA seqDB search
MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGY
GSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGGAGSGFGFGGGAGGGFGLGGG
AGFGGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPSIQRVRTEEREQIKTLNNKFA
SFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRL
DSELRNMQDLVEDFKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEI
NFMKMFFDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESW
YQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQR
GELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECR
LSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLGGGLGGGLGGGLAGGSSGSYYSSSSGGV
GLGGGLSVGGSGFSASSGRGLGVGFGSGGGSSSSVKFVSTTSSSRKSFKS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccagtcaagtgtgtccttccggagcgggggcagtcgtagcttcagcaccgcc
tctgccatcaccccgtctgtctcccgcaccagcttcacctccgtgtcccggtccgggggt
ggcggtggtggtggcttcggcagggtcagccttgcgggtgcttgtggagtgggtggctat
ggcagccggagcctctacaacctggggggctccaagaggatatccatcagcactagtggt
ggcagcttcaggaaccggtttggtgctggtgctggaggcggctatggctttggaggtggt
gccggtagtggatttggtttcggcggtggagctggtggtggctttgggctcggtggcgga
gctggctttggaggtggcttcggtggccctggctttcctgtctgccctcctggaggtatc
caagaggtcactgtcaaccagagtctcctgactcccctcaacctgcaaatcgaccccagc
atccagagggtgaggaccgaggagcgcgagcagatcaagaccctcaacaataagtttgcc
tccttcatcgacaaggtgcggttcctggagcagcagaacaaggttctggacaccaagtgg
accctgctgcaggagcagggcaccaagactgtgaggcagaacctggagccgttgttcgag
cagtacatcaacaacctcaggaggcagctggacagcatcgtgggggaacggggccgcctg
gactcagagctgagaaacatgcaggacctggtggaagacttcaagaacaagtatgaggat
gaaatcaacaagcgtaccactgctgagaatgagtttgtgatgctgaagaaggatgtagat
gctgcctacatgaacaaggtggagctggaggccaaggttgatgcactgatggatgagatt
aacttcatgaagatgttctttgatgcggagctgtcccagatgcagacgcatgtctctgac
acctcagtggtcctctccatggacaacaaccgcaacctggacctggatagcatcatcgct
gaggtcaaggcccagtatgaggagattgccaaccgcagccggacagaagccgagtcctgg
tatcagaccaagtatgaggagctgcagcagacagctggccggcatggcgatgacctccgc
aacaccaagcatgagatctctgagatgaaccggatgatccagaggctgagagccgagatt
gacaatgtcaagaaacagtgcgccaatctgcagaacgccattgcggatgccgagcagcgt
ggggagctggccctcaaggatgccaggaacaagctggccgagctggaggaggccctgcag
aaggccaagcaggacatggcccggctgctgcgtgagtaccaggagctcatgaacaccaag
ctggccctggacgtggagatcgccacttaccgcaagctgctggagggcgaggaatgcaga
ctcagtggagaaggagttggaccagtcaacatctctgttgtcacaagcagtgtttcctct
ggatatggcagtggcagtggctatggcggtggcctcggtggaggtcttggcggcggcctc
ggtggaggtcttgccggaggtagcagtggaagctactactccagcagcagtgggggtgtc
ggcctaggtggtgggctcagtgtggggggctctggcttcagtgcaagcagtggccgaggg
ctgggggtgggctttggcagtggcgggggtagcagctccagcgtcaaatttgtctccacc
acctcctcctcccggaagagcttcaagagctaa

DBGET integrated database retrieval system