KEGG   Homo sapiens (human): 3852Help
Entry
3852              CDS       T01001                                 

Gene name
KRT5, CK5, DDD, DDD1, EBS2, K5, KRT5A
Definition
(RefSeq) keratin 5
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00584  Epidermolysis bullosa simplex
H00944  Dowling-Degos disease
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3852 (KRT5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3852 (KRT5)
  Exosomal proteins of other body fluids (saliva and urine)
   3852 (KRT5)
  Exosomal proteins of colorectal cancer cells
   3852 (KRT5)
  Exosomal proteins of bladder cancer cells
   3852 (KRT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 AAA_13 Spc7 CENP-F_leu_zip ATG16 Reo_sigmaC Tropomyosin_1 Taxilin DUF745 Golgin_A5 Alanine_zipper Baculo_PEP_C DUF5082 IncA ADIP DUF3584 Jnk-SapK_ap_N Lebercilin
Motif
Other DBs
NCBI-GeneID: 3852
NCBI-ProteinID: NP_000415
OMIM: 148040
HGNC: 6442
Ensembl: ENSG00000186081
Vega: OTTHUMG00000169657
Pharos: P13647(Tbio)
UniProt: P13647
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 590 aa AA seqDB search
MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGY
GSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGGAGSGFGFGGGAGGGFGLGGG
AGFGGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPSIQRVRTEEREQIKTLNNKFA
SFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRL
DSELRNMQDLVEDFKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEI
NFMKMFFDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESW
YQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQR
GELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECR
LSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLGGGLGGGLGGGLAGGSSGSYYSSSSGGV
GLGGGLSVGGSGFSASSGRGLGVGFGSGGGSSSSVKFVSTTSSSRKSFKS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccagtcaagtgtgtccttccggagcgggggcagtcgtagcttcagcaccgcc
tctgccatcaccccgtctgtctcccgcaccagcttcacctccgtgtcccggtccgggggt
ggcggtggtggtggcttcggcagggtcagccttgcgggtgcttgtggagtgggtggctat
ggcagccggagcctctacaacctggggggctccaagaggatatccatcagcactagtggt
ggcagcttcaggaaccggtttggtgctggtgctggaggcggctatggctttggaggtggt
gccggtagtggatttggtttcggcggtggagctggtggtggctttgggctcggtggcgga
gctggctttggaggtggcttcggtggccctggctttcctgtctgccctcctggaggtatc
caagaggtcactgtcaaccagagtctcctgactcccctcaacctgcaaatcgaccccagc
atccagagggtgaggaccgaggagcgcgagcagatcaagaccctcaacaataagtttgcc
tccttcatcgacaaggtgcggttcctggagcagcagaacaaggttctggacaccaagtgg
accctgctgcaggagcagggcaccaagactgtgaggcagaacctggagccgttgttcgag
cagtacatcaacaacctcaggaggcagctggacagcatcgtgggggaacggggccgcctg
gactcagagctgagaaacatgcaggacctggtggaagacttcaagaacaagtatgaggat
gaaatcaacaagcgtaccactgctgagaatgagtttgtgatgctgaagaaggatgtagat
gctgcctacatgaacaaggtggagctggaggccaaggttgatgcactgatggatgagatt
aacttcatgaagatgttctttgatgcggagctgtcccagatgcagacgcatgtctctgac
acctcagtggtcctctccatggacaacaaccgcaacctggacctggatagcatcatcgct
gaggtcaaggcccagtatgaggagattgccaaccgcagccggacagaagccgagtcctgg
tatcagaccaagtatgaggagctgcagcagacagctggccggcatggcgatgacctccgc
aacaccaagcatgagatctctgagatgaaccggatgatccagaggctgagagccgagatt
gacaatgtcaagaaacagtgcgccaatctgcagaacgccattgcggatgccgagcagcgt
ggggagctggccctcaaggatgccaggaacaagctggccgagctggaggaggccctgcag
aaggccaagcaggacatggcccggctgctgcgtgagtaccaggagctcatgaacaccaag
ctggccctggacgtggagatcgccacttaccgcaagctgctggagggcgaggaatgcaga
ctcagtggagaaggagttggaccagtcaacatctctgttgtcacaagcagtgtttcctct
ggatatggcagtggcagtggctatggcggtggcctcggtggaggtcttggcggcggcctc
ggtggaggtcttgccggaggtagcagtggaagctactactccagcagcagtgggggtgtc
ggcctaggtggtgggctcagtgtggggggctctggcttcagtgcaagcagtggccgaggg
ctgggggtgggctttggcagtggcgggggtagcagctccagcgtcaaatttgtctccacc
acctcctcctcccggaagagcttcaagagctaa

DBGET integrated database retrieval system