KEGG   Homo sapiens (human): 3852Help
Entry
3852              CDS       T01001                                 

Gene name
KRT5, CK5, DDD, DDD1, EBS2, K5, KRT5A
Definition
(RefSeq) keratin 5, type II
  KO
K07605  
type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00584  
Epidermolysis bullosa simplex
H00944  
Dowling-Degos disease
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3852 (KRT5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3852 (KRT5)
  Exosomal proteins of other body fluids (saliva and urine)
   3852 (KRT5)
  Exosomal proteins of colorectal cancer cells
   3852 (KRT5)
  Exosomal proteins of bladder cancer cells
   3852 (KRT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 590 aa AA seqDB search
MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGY
GSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGGAGSGFGFGGGAGGGFGLGGG
AGFGGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPSIQRVRTEEREQIKTLNNKFA
SFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRL
DSELRNMQDLVEDFKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEI
NFMKMFFDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESW
YQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQR
GELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECR
LSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLGGGLGGGLGGGLAGGSSGSYYSSSSGGV
GLGGGLSVGGSGFSASSGRGLGVGFGSGGGSSSSVKFVSTTSSSRKSFKS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccagtcaagtgtgtccttccggagcgggggcagtcgtagcttcagcaccgcc
tctgccatcaccccgtctgtctcccgcaccagcttcacctccgtgtcccggtccgggggt
ggcggtggtggtggcttcggcagggtcagccttgcgggtgcttgtggagtgggtggctat
ggcagccggagcctctacaacctggggggctccaagaggatatccatcagcactagtggt
ggcagcttcaggaaccggtttggtgctggtgctggaggcggctatggctttggaggtggt
gccggtagtggatttggtttcggcggtggagctggtggtggctttgggctcggtggcgga
gctggctttggaggtggcttcggtggccctggctttcctgtctgccctcctggaggtatc
caagaggtcactgtcaaccagagtctcctgactcccctcaacctgcaaatcgaccccagc
atccagagggtgaggaccgaggagcgcgagcagatcaagaccctcaacaataagtttgcc
tccttcatcgacaaggtgcggttcctggagcagcagaacaaggttctggacaccaagtgg
accctgctgcaggagcagggcaccaagactgtgaggcagaacctggagccgttgttcgag
cagtacatcaacaacctcaggaggcagctggacagcatcgtgggggaacggggccgcctg
gactcagagctgagaaacatgcaggacctggtggaagacttcaagaacaagtatgaggat
gaaatcaacaagcgtaccactgctgagaatgagtttgtgatgctgaagaaggatgtagat
gctgcctacatgaacaaggtggagctggaggccaaggttgatgcactgatggatgagatt
aacttcatgaagatgttctttgatgcggagctgtcccagatgcagacgcatgtctctgac
acctcagtggtcctctccatggacaacaaccgcaacctggacctggatagcatcatcgct
gaggtcaaggcccagtatgaggagattgccaaccgcagccggacagaagccgagtcctgg
tatcagaccaagtatgaggagctgcagcagacagctggccggcatggcgatgacctccgc
aacaccaagcatgagatctctgagatgaaccggatgatccagaggctgagagccgagatt
gacaatgtcaagaaacagtgcgccaatctgcagaacgccattgcggatgccgagcagcgt
ggggagctggccctcaaggatgccaggaacaagctggccgagctggaggaggccctgcag
aaggccaagcaggacatggcccggctgctgcgtgagtaccaggagctcatgaacaccaag
ctggccctggacgtggagatcgccacttaccgcaagctgctggagggcgaggaatgcaga
ctcagtggagaaggagttggaccagtcaacatctctgttgtcacaagcagtgtttcctct
ggatatggcagtggcagtggctatggcggtggcctcggtggaggtcttggcggcggcctc
ggtggaggtcttgccggaggtagcagtggaagctactactccagcagcagtgggggtgtc
ggcctaggtggtgggctcagtgtggggggctctggcttcagtgcaagcagtggccgaggg
ctgggggtgggctttggcagtggcgggggtagcagctccagcgtcaaatttgtctccacc
acctcctcctcccggaagagcttcaagagctaa

DBGET integrated database retrieval system