KEGG   Homo sapiens (human): 386618Help
Entry
386618            CDS       T01001                                 

Gene name
KCTD4, bA321C24.3
Definition
(RefSeq) potassium channel tetramerization domain containing 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
13q14.12
AA seq 259 aa AA seqDB search
MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLE
GIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLK
GLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRL
DGFPEEFSISSNIIQFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLT
SLDCSKGSIVHSDALHFIK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtaaaataaacagaagagaaaaagaaaaggagtatgaagggaaacacaacagc
ctggaagatactgatcaaggaaagaactgcaaatccacactgatgaccctcaacgttggt
ggatatttatacattactcaaaaacaaacactgaccaagtacccagacactttccttgaa
ggtatagtaaatggaaaaatcctctgcccgtttgatgctgatggtcattatttcatagac
agggatggtctcctcttcaggcatgtcctaaacttcctacgaaatggagaacttctattg
cccgaagggtttcgagaaaatcaacttcttgcacaagaagcagaattctttcagctcaag
ggactggcagaggaagtgaaatccaggtgggagaaagaacagctaacacccagagagact
actttcttggaaataacagataaccacgatcgttcacaaggattaagaatcttctgtaat
gctcctgatttcatatcaaaaataaagtctcgcattgttctggtgtccaaaagcaggctg
gatggatttccagaggagttttcaatatcgtcaaatatcatccaatttaaatacttcata
aagtctgaaaatggcactcgacttgtactaaaggaagacaacacctttgtctgtaccttg
gaaactcttaagtttgaggctatcatgatggctttaaagtgtggctttagactgctgacc
agcctggattgttccaaagggtcaattgttcacagcgatgcacttcattttatcaagtaa

DBGET integrated database retrieval system