KEGG   Homo sapiens (human): 387082Help
Entry
387082            CDS       T01001                                 

Gene name
SUMO4, IDDM5, SMT3H4, SUMO-4, dJ281H8.4
Definition
small ubiquitin-like modifier 4
Orthology
K12160  
small ubiquitin-related modifier
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    387082 (SUMO4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    387082 (SUMO4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25
AA seq 95 aa AA seqDB search
MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRF
RFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgaaaagcccacagaagaagtcaagactgagaacaacaatcatattaatttg
aaggtggcgggacaggatggttctgtggtgcagtttaagattaagaggcagacaccactt
agtaaactaatgaaagcctattgtgaaccacggggattgtcagtgaagcagatcagattc
cgatttggtgggcaaccaatcagtggaacagacaaacctgcacagttggaaatggaagat
gaagatacaattgatgtgtttcaacagcctacgggaggtgtctactga

DBGET integrated database retrieval system