KEGG   Homo sapiens (human): 387129Help
Entry
387129            CDS       T01001                                 

Gene name
NPSR1, ASRT2, GPR154, GPRA, NPSR, PGR14, VRR1
Definition
(RefSeq) neuropeptide S receptor 1
  KO
K08376  
neuropeptide S receptor 1
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide S
    387129 (NPSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p14.3
AA seq 371 aa AA seqDB search
MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLF
VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLV
CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIP
TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIK
SKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFN
LLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERH
EMQILSKPEFI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaacttcacagagggcagcttcgattccagtgggaccgggcagacgctggat
tcttccccagtggcttgcactgaaacagtgacttttactgaagtggtggaaggaaaggaa
tggggttccttctactactcctttaagactgagcaattgataactctgtgggtcctcttt
gtttttaccattgttggaaactccgttgtgcttttttccacatggaggagaaagaagaag
tcaagaatgaccttctttgtgactcagctggccatcacagattctttcacaggactggtc
aacatcttgacagatattaattggcgattcactggagacttcacggcacctgacctggtt
tgccgagtggtccgctatttgcaggttgtgctgctctacgcctctacctacgtcctggtg
tccctcagcatagacagataccatgccatcgtctaccccatgaagttccttcaaggagaa
aagcaagccagggtcctcattgtgatcgcctggagcctgtcttttctgttctccattccc
accctgatcatatttgggaagaggacactgtccaacggtgaagtgcagtgctgggccctg
tggcctgacgactcctactggaccccatacatgaccatcgtggccttcctggtgtacttc
atccctctgacaatcatcagcatcatgtatggcattgtgatccgaactatttggattaaa
agcaaaacctacgaaacagtgatttccaactgctcagatgggaaactgtgcagcagctat
aaccgaggactcatctcaaaggcaaaaatcaaggctatcaagtatagcatcatcatcatt
cttgccttcatctgctgttggagtccatacttcctgtttgacattttggacaatttcaac
ctccttccagacacccaggagcgtttctatgcctctgtgatcattcagaacctgccagca
ttgaatagtgccatcaaccccctcatctactgtgtcttcagcagctccatctctttcccc
tgcagggagcaaagatcacaggattccagaatgacgttccgggagagaactgagaggcat
gagatgcagattctgtccaagccagaattcatctag

DBGET integrated database retrieval system