KEGG   Homo sapiens (human): 387707Help
Entry
387707            CDS       T01001                                 

Gene name
CC2D2B, C10orf130, C10orf131, bA248J23.4, bA690P14.3
Definition
(RefSeq) coiled-coil and C2 domain containing 2B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6DHV5(Tdark)
UniProt: 
Position
10q24.1
AA seq 401 aa AA seqDB search
MMTEKHEDHCLKSCSGHSYIRKNWLGCIVFPFSALLQQSEFLDQTEVLQRAQIFKKNCKA
MFPNRRIVTTVFNDEGIQFLVTRYIKALNPPQQLLDIFLHNSNATFDLIARFVSLIPFVP
NTPDENDGSDIWMTSEHCISLAIGNKEEHAILLCNFFLYFGKKALVLLGTSVLEGHVAYV
VTQETNEYLLWNPSTGQCYKQFDPFCPLKSVDCLFDDRNVWFNIQQNNTPMAVFFDYSKE
SFWKQLLPKNVQGTKIQSIQPEEIIYFETDKSMVEDLRNRIERTLKSKVMEWRPKHPTHW
NRQCTFILRQILPKLEFGIGSFVSSEGDNEFERILQFYWVTGFPIQMPYIDVQSIIDAVY
QTGIHSAEFPQTEFALAVYIHPYPNNILSVWVYLASLVQHQ
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgaaaaacatgaggatcactgtctcaagagctgtagtggtcactcatatata
agaaagaattggcttggatgcattgtcttccctttttctgctcttctgcaacaatctgag
tttttagatcaaacagaggtcttgcagagagcacagatttttaaaaagaattgtaaggca
atgtttcccaaccgaagaatcgtaactactgtttttaatgatgaagggatacagttctta
gtcacaagatatatcaaggcattaaatccacctcagcaacttctggatatatttcttcac
aattctaatgcaacatttgacctcattgctcgatttgtatctttgattccttttgtgcct
aatacaccagatgaaaatgatggctctgatatatggatgacatcagagcactgcatcagt
ttagctatcggaaataaggaggagcatgccatccttctctgtaatttctttctgtatttt
ggaaagaaggcactggtcctcttgggaacgtcagtgttagaagggcatgtggcttatgta
gtaactcaagaaactaatgaatatttgctttggaatccatcaactggccaatgttataag
cagtttgacccgttttgtcccttaaaaagtgtagattgtttgtttgatgatagaaatgtc
tggtttaatattcaacaaaataatacaccaatggctgtattttttgactattcaaaggaa
agtttctggaagcagttgcttccaaaaaacgttcaaggaacaaaaatacaaagcatacag
cctgaagaaataatttattttgaaactgataaaagcatggtagaagatctaaggaatagg
atcgaaaggactctgaagagtaaagtgatggaatggcgacctaaacacccaacacattgg
aatcgacagtgtacttttattttgcgacaaatccttcctaagctggaatttggcatagga
agctttgtttcatctgaaggagataatgaatttgaaagaatactacaattttattgggtc
acgggatttcccatccagatgccatacattgatgtacagtcaattattgatgctgtttat
caaactggaattcactctgctgaatttccccagacagaatttgctttagctgtatacatt
cacccatacccaaacaacatattatctgtgtgggtctatttggcttccttagttcaacat
caatga

DBGET integrated database retrieval system