KEGG   Homo sapiens (human): 387707Help
Entry
387707            CDS       T01001                                 

Gene name
CC2D2B, C10orf130, bA248J23.4
Definition
coiled-coil and C2 domain containing 2B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24.1
AA seq 322 aa AA seqDB search
MMTEKHEDHCLKSCSGHSYIRKNWLGCIVFPFSALLQQSEFLDQTEVLQRAQIFKKNCKA
MFPNRRIVTTVFNDEGIQFLVTRYIKALNPPQQLLDIFLHNSNATFDLIARFVSLIPFVP
NTPDENDGSDIWMTSEHCISLAIGNKEEHAILLCNFFLYFGKKALVLLGTSVLEGHVAYV
VTQETNEYLLWNPSTGQCYKQFDPFCPLKSVDCLFDDRNVWFNIQQNNTPMAVFFDYSKE
SFWKQLLPKNVQGTKIQSIQVTGFPIQMPYIDVQSIIDAVYQTGIHSAEFPQTEFALAVY
IHPYPNNILSVWVYLASLVQHQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgaaaaacatgaggatcactgtctcaagagctgtagtggtcactcatatata
agaaagaattggcttggatgcattgtcttccctttttctgctcttctgcaacaatctgag
tttttagatcaaacagaggtcttgcagagagcacagatttttaaaaagaattgtaaggca
atgtttcccaaccgaagaatcgtaactactgtttttaatgatgaagggatacagttctta
gtcacaagatatatcaaggcattaaatccacctcagcaacttctggatatatttcttcac
aattctaatgcaacatttgacctcattgctcgatttgtatctttgattccttttgtgcct
aatacaccagatgaaaatgatggctctgatatatggatgacatcagagcactgcatcagt
ttagctatcggaaataaggaggagcatgccatccttctctgtaatttctttctgtatttt
ggaaagaaggcactggtcctcttgggaacgtcagtgttagaagggcatgtggcttatgta
gtaactcaagaaactaatgaatatttgctttggaatccatcaactggccaatgttataag
cagtttgacccgttttgtcccttaaaaagtgtagattgtttgtttgatgatagaaatgtc
tggtttaatattcaacaaaataatacaccaatggctgtattttttgactattcaaaggaa
agtttctggaagcagttgcttccaaaaaacgttcaaggaacaaaaatacaaagcatacag
gtcacgggatttcccatccagatgccatacattgatgtacagtcaattattgatgctgtt
tatcaaactggaattcactctgctgaatttccccagacagaatttgctttagctgtatac
attcacccatacccaaacaacatattatctgtgtgggtctatttggcttccttagttcaa
catcaatga

DBGET integrated database retrieval system