KEGG   Homo sapiens (human): 387748Help
Entry
387748            CDS       T01001                                 

Gene name
OR56B1, OR11-65, OR56B1P
Definition
(RefSeq) olfactory receptor family 56 subfamily B member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    387748 (OR56B1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    387748 (OR56B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 387748
NCBI-ProteinID: NP_001005180
HGNC: 15245
Ensembl: ENSG00000181023
Vega: OTTHUMG00000066891
Pharos: Q8NGI3(Tdark)
UniProt: Q8NGI3
Position
11p15.4
AA seq 324 aa AA seqDB search
MNHMSASLKISNSSKFQVSEFILLGFPGIHSWQHWLSLPLALLYLSALAANTLILIIIWQ
NPSLQQPMYIFLGILCMVDMGLATTIIPKILAIFWFDAKVISLPECFAQIYAIHFFVGME
SGILLCMAFDRYVAICHPLRYPSIVTSSLILKATLFMVLRNGLFVTPVPVLAAQRDYCSK
NEIEHCLCSNLGVTSLACDDRRPNSICQLVLAWLGMGSDLSLIILSYILILYSVLRLNSA
EAAAKALSTCSSHLTLILFFYTIVVVISVTHLTEMKATLIPVLLNVLHNIIPPSLNPTVY
ALQTKELRAAFQKVLFALTKEIRS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatatgtctgcatctctcaaaatctccaatagctccaaattccaggtctctgag
ttcatcctgctgggattcccgggcattcacagctggcaacactggctatctctgcccctg
gcactactgtatctctcagcacttgctgcaaacaccctcatcctcatcatcatctggcag
aacccttctttacagcagcccatgtatattttccttggcatcctctgtatggtagacatg
ggtctggccactactatcatccctaagatcctggccatcttctggtttgatgccaaggtt
attagcctccctgagtgctttgctcagatttatgccattcacttctttgtgggcatggag
tctggtatcctactctgcatggcttttgatagatatgtggctatttgtcaccctcttcgc
tatccatcaattgtcaccagttccttaatcttaaaagctaccctgttcatggtgctgaga
aatggcttatttgtcactccagtgcctgtgcttgcagcacagcgtgattattgctccaag
aatgaaattgaacactgcctgtgctctaaccttggggtcacaagcctggcttgtgatgac
aggaggccaaacagcatttgccagttggttctggcatggcttggaatggggagtgatcta
agtcttattatactgtcatatattttgattctgtactctgtacttagactgaactcagct
gaagctgcagccaaggccctgagcacttgtagttcacatctcaccctcatccttttcttt
tacactattgttgtagtgatttcagtgactcatctgacagagatgaaggctactttgatt
ccagttctacttaatgtgttgcacaacatcatccccccttccctcaaccctacagtttat
gcacttcagaccaaagaacttagggcagccttccaaaaggtgctgtttgcccttacaaaa
gaaataagatcttag

DBGET integrated database retrieval system