KEGG   Homo sapiens (human): 387748Help
Entry
387748            CDS       T01001                                 

Gene name
OR56B1, OR11-65, OR56B1P
Definition
olfactory receptor, family 56, subfamily B, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    387748 (OR56B1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    387748 (OR56B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 324 aa AA seqDB search
MNHMSASLKISNSSKFQVSEFILLGFPGIHSWQHWLSLPLALLYLSALAANTLILIIIWQ
NPSLQQPMYIFLGILCMVDMGLATTIIPKILAIFWFDAKVISLPECFAQIYAIHFFVGME
SGILLCMAFDRYVAICHPLRYPSIVTSSLILKATLFMVLRNGLFVTPVPVLAAQRDYCSK
NEIEHCLCSNLGVTSLACDDRRPNSICQLVLAWLGMGSDLSLIILSYILILYSVLRLNSA
EAAAKALSTCSSHLTLILFFYTIVVVISVTHLTEMKATLIPVLLNVLHNIIPPSLNPTVY
ALQTKELRAAFQKVLFALTKEIRS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatatgtctgcatctctcaaaatctccaatagctccaaattccaggtctctgag
ttcatcctgctgggattcccgggcattcacagctggcaacactggctatctctgcccctg
gcactactgtatctctcagcacttgctgcaaacaccctcatcctcatcatcatctggcag
aacccttctttacagcagcccatgtatattttccttggcatcctctgtatggtagacatg
ggtctggccactactatcatccctaagatcctggccatcttctggtttgatgccaaggtt
attagcctccctgagtgctttgctcagatttatgccattcacttctttgtgggcatggag
tctggtatcctactctgcatggcttttgatagatatgtggctatttgtcaccctcttcgc
tatccatcaattgtcaccagttccttaatcttaaaagctaccctgttcatggtgctgaga
aatggcttatttgtcactccagtgcctgtgcttgcagcacagcgtgattattgctccaag
aatgaaattgaacactgcctgtgctctaaccttggggtcacaagcctggcttgtgatgac
aggaggccaaacagcatttgccagttggttctggcatggcttggaatggggagtgatcta
agtcttattatactgtcatatattttgattctgtactctgtacttagactgaactcagct
gaagctgcagccaaggccctgagcacttgtagttcacatctcaccctcatccttttcttt
tacactattgttgtagtgatttcagtgactcatctgacagagatgaaggctactttgatt
ccagttctacttaatgtgttgcacaacatcatccccccttccctcaaccctacagtttat
gcacttcagaccaaagaacttagggcagccttccaaaaggtgctgtttgcccttacaaaa
gaaataagatcttag

DBGET integrated database retrieval system