KEGG   Homo sapiens (human): 387778Help
Entry
387778            CDS       T01001                                 

Gene name
SPDYC, RINGOC, Ringo2
Definition
(RefSeq) speedy/RINGO cell cycle regulator family member C
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    387778 (SPDYC)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    387778 (SPDYC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spy1
Motif
Other DBs
NCBI-GeneID: 387778
NCBI-ProteinID: NP_001008778
OMIM: 614030
HGNC: 32681
Ensembl: ENSG00000204710
Vega: OTTHUMG00000165611
Pharos: Q5MJ68(Tdark)
UniProt: Q5MJ68
Position
11q13.1
AA seq 293 aa AA seqDB search
MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQ
AFLSLLEDSFVQEFLSKDPCFQISDKYLLAMVLVYFQRAHLKLSEYTHSSLFLALYLAND
MEEDLEGPKCEIFPWALGKDWCLRVGKFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPFH
WAWTRDRRPHHGGVQRVCPQVPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSL
TSECHRPPSQNYLSRVKNAWGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggccattcctgagctcgggtcaccctgccccatctccatctcctatgagatg
agtgactcccaagaccccaccacttcccctgtagttaccacccaggtagagctggggggc
tgcagccggcaaggtgggggcaatgggttcctccgttttcgccagcaccaggaggtccag
gccttcctcagccttctggaggacagttttgtccaggaattcctctccaaagacccctgc
ttccagatttcagataagtatctcctggccatggtgctggtctacttccagcgcgcccac
ctgaagctcagcgagtatacccacagcagcctgttcttggccctgtaccttgcaaacgac
atggaggaggacctggagggccccaaatgtgagatttttccatgggccctgggaaaagat
tggtgtttacgagtggggaaattcctgcaccagagggataagctttgggcacggatgggt
ttccgggctgttgtgagccgccagtgctgtgaggaggtcatggcaaaggagccattccac
tgggcttggactcgggaccggcgcccccaccatggtggggttcagagggtctgtccacag
gtccctgttcgccttccccggggccctggcctctcgccgccccactgttccccctgtggt
ttgccccagcactgcagcagccacttgcttaagcctgtgtcatccaagtgcccttctctg
acctctgaatgtcatcgccctccctcccaaaattatctctcaagggtcaaaaacgcctgg
ggtggggactttctcatcgtcttgcctccccagatgcaactggaaccaggcacctactcc
ctccgcatcttcccaaagcctccggcacgccctgggcactga

DBGET integrated database retrieval system