KEGG   Homo sapiens (human): 387778Help
Entry
387778            CDS       T01001                                 

Gene name
SPDYC, RINGOC, Ringo2
Definition
speedy/RINGO cell cycle regulator family member C
Orthology
K08694  
speedy
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    387778 (SPDYC)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    387778 (SPDYC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.1
AA seq 293 aa AA seqDB search
MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQ
AFLSLLEDSFVQEFLSKDPCFQISDKYLLAMVLVYFQRAHLKLSEYTHSSLFLALYLAND
MEEDLEGPKCEIFPWALGKDWCLRVGKFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPFH
WAWTRDRRPHHGGVQRVCPQVPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSL
TSECHRPPSQNYLSRVKNAWGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggccattcctgagctcgggtcaccctgccccatctccatctcctatgagatg
agtgactcccaagaccccaccacttcccctgtagttaccacccaggtagagctggggggc
tgcagccggcaaggtgggggcaatgggttcctccgttttcgccagcaccaggaggtccag
gccttcctcagccttctggaggacagttttgtccaggaattcctctccaaagacccctgc
ttccagatttcagataagtatctcctggccatggtgctggtctacttccagcgcgcccac
ctgaagctcagcgagtatacccacagcagcctgttcttggccctgtaccttgcaaacgac
atggaggaggacctggagggccccaaatgtgagatttttccatgggccctgggaaaagat
tggtgtttacgagtggggaaattcctgcaccagagggataagctttgggcacggatgggt
ttccgggctgttgtgagccgccagtgctgtgaggaggtcatggcaaaggagccattccac
tgggcttggactcgggaccggcgcccccaccatggtggggttcagagggtctgtccacag
gtccctgttcgccttccccggggccctggcctctcgccgccccactgttccccctgtggt
ttgccccagcactgcagcagccacttgcttaagcctgtgtcatccaagtgcccttctctg
acctctgaatgtcatcgccctccctcccaaaattatctctcaagggtcaaaaacgcctgg
ggtggggactttctcatcgtcttgcctccccagatgcaactggaaccaggcacctactcc
ctccgcatcttcccaaagcctccggcacgccctgggcactga

DBGET integrated database retrieval system