KEGG   Homo sapiens (human): 3880Help
Entry
3880              CDS       T01001                                 

Gene name
KRT19, CK19, K19, K1CS
Definition
(RefSeq) keratin 19
  KO
K07604  
type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
Estrogen signaling pathway
Network
N00286  
Nuclear-initiated estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    3880 (KRT19)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3880 (KRT19)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3880 (KRT19)
  Exosomal proteins of other body fluids (saliva and urine)
   3880 (KRT19)
  Exosomal proteins of colorectal cancer cells
   3880 (KRT19)
  Exosomal proteins of melanoma cells
   3880 (KRT19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P08727(Tbio)
UniProt: 
Position
17q21.2
AA seq 400 aa AA seqDB search
MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA
YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA
PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctacagctatcgccagtcgtcggccacgtcgtccttcggaggcctgggcggc
ggctccgtgcgttttgggccgggggtcgcctttcgcgcgcccagcattcacgggggctcc
ggcggccgcggcgtatccgtgtcctccgcccgctttgtgtcctcgtcctcctcgggggcc
tacggcggcggctacggcggcgtcctgaccgcgtccgacgggctgctggcgggcaacgag
aagctaaccatgcagaacctcaacgaccgcctggcctcctacctggacaaggtgcgcgcc
ctggaggcggccaacggcgagctagaggtgaagatccgcgactggtaccagaagcagggg
cctgggccctcccgcgactacagccactactacacgaccatccaggacctgcgggacaag
attcttggtgccaccattgagaactccaggattgtcctgcagatcgacaatgcccgtctg
gctgcagatgacttccgaaccaagtttgagacggaacaggctctgcgcatgagcgtggag
gccgacatcaacggcctgcgcagggtgctggatgagctgaccctggccaggaccgacctg
gagatgcagatcgaaggcctgaaggaagagctggcctacctgaagaagaaccatgaggag
gaaatcagtacgctgaggggccaagtgggaggccaggtcagtgtggaggtggattccgct
ccgggcaccgatctcgccaagatcctgagtgacatgcgaagccaatatgaggtcatggcc
gagcagaaccggaaggatgctgaagcctggttcaccagccggactgaagaattgaaccgg
gaggtcgctggccacacggagcagctccagatgagcaggtccgaggttactgacctgcgg
cgcacccttcagggtcttgagattgagctgcagtcacagctgagcatgaaagctgccttg
gaagacacactggcagaaacggaggcgcgctttggagcccagctggcgcatatccaggcg
ctgatcagcggtattgaagcccagctgggcgatgtgcgagctgatagtgagcggcagaat
caggagtaccagcggctcatggacatcaagtcgcggctggagcaggagattgccacctac
cgcagcctgctcgagggacaggaagatcactacaacaatttgtctgcctccaaggtcctc
tga

DBGET integrated database retrieval system