KEGG   Homo sapiens (human): 3880Help
Entry
3880              CDS       T01001                                 

Gene name
KRT19, CK19, K19, K1CS
Definition
keratin 19
Orthology
K07604  
type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.2
AA seq 400 aa AA seqDB search
MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA
YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA
PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctacagctatcgccagtcgtcggccacgtcgtccttcggaggcctgggcggc
ggctccgtgcgttttgggccgggggtcgcctttcgcgcgcccagcattcacgggggctcc
ggcggccgcggcgtatccgtgtcctccgcccgctttgtgtcctcgtcctcctcgggggcc
tacggcggcggctacggcggcgtcctgaccgcgtccgacgggctgctggcgggcaacgag
aagctaaccatgcagaacctcaacgaccgcctggcctcctacctggacaaggtgcgcgcc
ctggaggcggccaacggcgagctagaggtgaagatccgcgactggtaccagaagcagggg
cctgggccctcccgcgactacagccactactacacgaccatccaggacctgcgggacaag
attcttggtgccaccattgagaactccaggattgtcctgcagatcgacaatgcccgtctg
gctgcagatgacttccgaaccaagtttgagacggaacaggctctgcgcatgagcgtggag
gccgacatcaacggcctgcgcagggtgctggatgagctgaccctggccaggaccgacctg
gagatgcagatcgaaggcctgaaggaagagctggcctacctgaagaagaaccatgaggag
gaaatcagtacgctgaggggccaagtgggaggccaggtcagtgtggaggtggattccgct
ccgggcaccgatctcgccaagatcctgagtgacatgcgaagccaatatgaggtcatggcc
gagcagaaccggaaggatgctgaagcctggttcaccagccggactgaagaattgaaccgg
gaggtcgctggccacacggagcagctccagatgagcaggtccgaggttactgacctgcgg
cgcacccttcagggtcttgagattgagctgcagtcacagctgagcatgaaagctgccttg
gaagacacactggcagaaacggaggcgcgctttggagcccagctggcgcatatccaggcg
ctgatcagcggtattgaagcccagctgggcgatgtgcgagctgatagtgagcggcagaat
caggagtaccagcggctcatggacatcaagtcgcggctggagcaggagattgccacctac
cgcagcctgctcgagggacaggaagatcactacaacaatttgtctgcctccaaggtcctc
tga

DBGET integrated database retrieval system