KEGG   Homo sapiens (human): 388228Help
Entry
388228            CDS       T01001                                 

Gene name
SBK1, SBK
Definition
(RefSeq) SH3 domain binding kinase 1 (EC:2.7.11.1)
  KO
K08858  
serine/threonine-protein kinase SBK [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     388228 (SBK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  NKF1 family
   388228 (SBK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 424 aa AA seqDB search
MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELG
KGTYGKVDLVVYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFET
EDCYVFAQEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENV
LLFDRECRRVKLADFGMTRRVGCRVKRVSGTIPYTAPEVCQAGRADGLAVDTGVDVWAFG
VLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEP
ERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGPLKRTVLTESG
SGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPPGRTDGRADKSKGQVVLATAI
EICV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgggctgcccagagcctgagccgccccgctccctgacctgctgtgggccgggg
actgcccctgggcctggtgccggtgtgccccttctcactgaagacatgcaggccctgact
ctccgcacactggccgccagcgacgtcaccaagcactacgaactagtccgggagctgggc
aaaggcacctatgggaaggttgacctggtggtctacaagggcacaggcacaaaaatggca
ctgaagtttgtgaacaagagcaaaaccaagctgaagaacttcctacgggaggtgagcatc
accaacagcctctcctccagccccttcatcatcaaggtctttgacgtggtctttgagaca
gaggactgctacgtctttgcccaggagtacgcacctgctggggacctgtttgacatcatc
cctccccaggtggggctccctgaggacacggtgaagcgctgtgtgcagcagctgggcctg
gcgctggacttcatgcacgggcggcagctggtgcaccgcgacatcaagcccgagaacgtg
ctgctgttcgaccgcgagtgccgccgcgtaaagctggccgacttcggcatgacgcgccgc
gtgggctgccgcgtcaagcgcgtgagcggcaccatcccttacacggcgcctgaggtgtgc
caggcgggccgcgccgacgggctggcggtggacacgggcgtggacgtgtgggccttcggc
gtgctcatcttctgcgtgctcaccggcaacttcccgtgggaggcggcgtcgggcgccgac
gccttcttcgaggagttcgtgcgctggcagcggggccgcctgccggggctgccttcgcag
tggcgccgcttcaccgagcccgcgctgcgcatgttccagcgcttactggccctggagccc
gagcgccgcggcccagccaaggaggtgttccgcttcctcaagcacgagctcacgtccgag
ctgcgccgccggccctcgcaccgcgcgcgcaagccccccggggaccgcccgcccgccgcc
gggccactgcgcctcgaggcgcctgggccgctcaagcggacggtgctgaccgagagcggc
agcggctcccggcccgcgccccccgccgtcgggtcggtgcccttgcccgtgccggtgccg
gtgccagtgcccgtgccggtgcctgtgcccgagcccggcctagctccccaggggcccccc
ggccggaccgacggccgcgcggacaagagcaaagggcaggtggtgctggccacggccatc
gagatctgcgtctga

DBGET integrated database retrieval system