KEGG   Homo sapiens (human): 3884Help
Entry
3884              CDS       T01001                                 

Gene name
KRT33B, HA3II, Ha-3II, K33B, KRTHA3A, KRTHA3B, hHa3-II
Definition
(RefSeq) keratin 33B
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    3884 (KRT33B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3884 (KRT33B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3884 (KRT33B)
  Exosomal proteins of other body fluids (saliva and urine)
   3884 (KRT33B)
  Exosomal proteins of colorectal cancer cells
   3884 (KRT33B)
  Exosomal proteins of melanoma cells
   3884 (KRT33B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Herpes_IE2_3 zf-C4H2
Motif
Other DBs
NCBI-GeneID: 3884
NCBI-ProteinID: NP_002270
OMIM: 602762
HGNC: 6451
Ensembl: ENSG00000131738
Vega: OTTHUMG00000133429
Pharos: Q14525(Tbio)
UniProt: Q14525
Position
17q21.2
AA seq 404 aa AA seqDB search
MPYNFCLPSLSCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLLCPSYQSYFKTIEELQQKILCS
KSENARLVVQIDNAKLAADDFRTKYQTEQSLRQLVESDINSLRRILDELTLCRSDLEAQM
ESLKEELLSLKQNHEQEVNTLRCQLGDRLNVEVDAAPAVDLNQVLNETRNQYEALVETNR
REVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRYSLENTL
TESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCKLPSNPCATTNACEKPIGSCVTNPCGPRSRCGPCNTFGY
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgccctacaacttctgcctgcccagcctgagctgccgcaccagctgctcctcccggccc
tgtgtgccccccagctgccacggctacaccctgcccggggcctgcaacatccctgccaat
gtgagcaactgcaactggttctgcgagggctccttcaatggcagcgagaaggagactatg
cagttcctgaacgaccgcctggccagctacctggagaaggtgcgtcagctggagcgggac
aacgcggagctggagaacctcatccgggagcggtctcagcagcaggagcccttgctgtgc
cccagctaccagtcctacttcaagaccattgaggagctccagcagaagatcctgtgcagc
aagtctgagaatgccaggctggtggtgcagatcgacaatgccaagctggctgcagatgac
ttcagaaccaagtaccagacggagcagtccctgcggcagctggtggagtccgacatcaac
agcctgcgcaggattctggatgagctgaccctgtgcaggtctgacctggaggcccagatg
gagtccctgaaggaggagctgctgtccctcaagcagaaccatgagcaggaagtcaacacc
ttgcgctgccagcttggagaccgcctcaacgtggaggtggacgctgctcccgctgtggac
ctgaaccaggtcctgaacgagaccaggaatcagtatgaggccctggtggaaaccaaccgc
agggaagtggagcaatggttcgccacgcagaccgaggagctgaacaagcaggtggtatcc
agctcggagcagctgcagtcctaccaggcggagatcatcgagctgagacgcacagtcaat
gccctggagatcgagctgcaggcccagcacaacctgcgatactctctggaaaacacgctg
acagagagcgaggcccgctacagctcccagctgtcccaggtgcagagcctgatcaccaac
gtggagtcccagctggcggagatccgcagtgacctggagcggcagaaccaggagtatcag
gtgctgctggacgtgcgggcgcggctggagtgtgagatcaacacataccggagcctgctg
gagagcgaggactgcaagctgccctccaacccctgcgccaccaccaatgcatgtgaaaag
cccattggatcctgtgtcaccaatccttgtggtcctcgttcccgctgtgggccttgcaac
acctttgggtactag

DBGET integrated database retrieval system