KEGG   Homo sapiens (human): 3884Help
Entry
3884              CDS       T01001                                 

Gene name
KRT33B, HA3II, Ha-3II, K33B, KRTHA3A, KRTHA3B, hHa3-II
Definition
(RefSeq) keratin 33B
  KO
K07604  
type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3884 (KRT33B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3884 (KRT33B)
  Exosomal proteins of other body fluids (saliva and urine)
   3884 (KRT33B)
  Exosomal proteins of colorectal cancer cells
   3884 (KRT33B)
  Exosomal proteins of melanoma cells
   3884 (KRT33B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.2
AA seq 404 aa AA seqDB search
MPYNFCLPSLSCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLLCPSYQSYFKTIEELQQKILCS
KSENARLVVQIDNAKLAADDFRTKYQTEQSLRQLVESDINSLRRILDELTLCRSDLEAQM
ESLKEELLSLKQNHEQEVNTLRCQLGDRLNVEVDAAPAVDLNQVLNETRNQYEALVETNR
REVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRYSLENTL
TESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCKLPSNPCATTNACEKPIGSCVTNPCGPRSRCGPCNTFGY
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgccctacaacttctgcctgcccagcctgagctgccgcaccagctgctcctcccggccc
tgtgtgccccccagctgccacggctacaccctgcccggggcctgcaacatccctgccaat
gtgagcaactgcaactggttctgcgagggctccttcaatggcagcgagaaggagactatg
cagttcctgaacgaccgcctggccagctacctggagaaggtgcgtcagctggagcgggac
aacgcggagctggagaacctcatccgggagcggtctcagcagcaggagcccttgctgtgc
cccagctaccagtcctacttcaagaccattgaggagctccagcagaagatcctgtgcagc
aagtctgagaatgccaggctggtggtgcagatcgacaatgccaagctggctgcagatgac
ttcagaaccaagtaccagacggagcagtccctgcggcagctggtggagtccgacatcaac
agcctgcgcaggattctggatgagctgaccctgtgcaggtctgacctggaggcccagatg
gagtccctgaaggaggagctgctgtccctcaagcagaaccatgagcaggaagtcaacacc
ttgcgctgccagcttggagaccgcctcaacgtggaggtggacgctgctcccgctgtggac
ctgaaccaggtcctgaacgagaccaggaatcagtatgaggccctggtggaaaccaaccgc
agggaagtggagcaatggttcgccacgcagaccgaggagctgaacaagcaggtggtatcc
agctcggagcagctgcagtcctaccaggcggagatcatcgagctgagacgcacagtcaat
gccctggagatcgagctgcaggcccagcacaacctgcgatactctctggaaaacacgctg
acagagagcgaggcccgctacagctcccagctgtcccaggtgcagagcctgatcaccaac
gtggagtcccagctggcggagatccgcagtgacctggagcggcagaaccaggagtatcag
gtgctgctggacgtgcgggcgcggctggagtgtgagatcaacacataccggagcctgctg
gagagcgaggactgcaagctgccctccaacccctgcgccaccaccaatgcatgtgaaaag
cccattggatcctgtgtcaccaatccttgtggtcctcgttcccgctgtgggccttgcaac
acctttgggtactag

DBGET integrated database retrieval system