KEGG   Homo sapiens (human): 388585Help
Entry
388585            CDS       T01001                                 

Gene name
HES5, bHLHb38
Definition
hes family bHLH transcription factor 5
Orthology
K06055  
hairy and enhancer of split 5
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    388585 (HES5)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    388585 (HES5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.32
AA seq 166 aa AA seqDB search
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcccccagcactgtggccgtggagctgctcagccccaaagagaaaaaccgactgcgg
aagccggtggtggagaagatgcgccgcgaccgcatcaacagcagcatcgagcagctgaag
ctgctgctggagcaggagttcgcgcggcaccagcccaactccaagctggagaaggccgac
atcctggagatggctgtcagctacctgaagcacagcaaagccttcgtcgccgccgccggc
cccaagagcctgcaccaggactacagcgaaggctactcgtggtgcctgcaggaggccgtg
cagttcctgacgctccacgccgccagcgacacgcagatgaagctgctgtaccacttccag
cggcccccggccgcgcccgccgcgcccgccaaggagcccaaggcgccgggcgccgcgccc
ccgcccgcgctctccgccaaggccaccgccgccgccgccgccgcgcaccagcccgcctgc
ggcctctggcggccctggtga

DBGET integrated database retrieval system