KEGG   Homo sapiens (human): 388585Help
Entry
388585            CDS       T01001                                 

Gene name
HES5, bHLHb38
Definition
(RefSeq) hes family bHLH transcription factor 5
  KO
K06055  
hairy and enhancer of split 5
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Human papillomavirus infection
Pathways in cancer
Breast cancer
Network
N00087  
NOTCH-overexpression to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    388585 (HES5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    388585 (HES5)
   05224 Breast cancer
    388585 (HES5)
  Infectious diseases
   05165 Human papillomavirus infection
    388585 (HES5)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    388585 (HES5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q5TA89(Tbio)
UniProt: 
Position
1p36.32
AA seq 166 aa AA seqDB search
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcccccagcactgtggccgtggagctgctcagccccaaagagaaaaaccgactgcgg
aagccggtggtggagaagatgcgccgcgaccgcatcaacagcagcatcgagcagctgaag
ctgctgctggagcaggagttcgcgcggcaccagcccaactccaagctggagaaggccgac
atcctggagatggctgtcagctacctgaagcacagcaaagccttcgtcgccgccgccggc
cccaagagcctgcaccaggactacagcgaaggctactcgtggtgcctgcaggaggccgtg
cagttcctgacgctccacgccgccagcgacacgcagatgaagctgctgtaccacttccag
cggcccccggccgcgcccgccgcgcccgccaaggagcccaaggcgccgggcgccgcgccc
ccgcccgcgctctccgccaaggccaccgccgccgccgccgccgcgcaccagcccgcctgc
ggcctctggcggccctggtga

DBGET integrated database retrieval system