KEGG   Homo sapiens (human): 388585Help
Entry
388585            CDS       T01001                                 

Gene name
HES5, bHLHb38
Definition
hes family bHLH transcription factor 5
Orthology
K06055  
hairy and enhancer of split 5
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.32
AA seq 166 aa AA seqDB search
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcccccagcactgtggccgtggagctgctcagccccaaagagaaaaaccgactgcgg
aagccggtggtggagaagatgcgccgcgaccgcatcaacagcagcatcgagcagctgaag
ctgctgctggagcaggagttcgcgcggcaccagcccaactccaagctggagaaggccgac
atcctggagatggctgtcagctacctgaagcacagcaaagccttcgtcgccgccgccggc
cccaagagcctgcaccaggactacagcgaaggctactcgtggtgcctgcaggaggccgtg
cagttcctgacgctccacgccgccagcgacacgcagatgaagctgctgtaccacttccag
cggcccccggccgcgcccgccgcgcccgccaaggagcccaaggcgccgggcgccgcgccc
ccgcccgcgctctccgccaaggccaccgccgccgccgccgccgcgcaccagcccgcctgc
ggcctctggcggccctggtga

DBGET integrated database retrieval system