KEGG   Homo sapiens (human): 3886Help
Entry
3886              CDS       T01001                                 

Gene name
KRT35, HA5, Ha-5, KRTHA5, hHa5
Definition
(RefSeq) keratin 35
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    3886 (KRT35)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     3886 (KRT35)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   3886 (KRT35)
  Exosomal proteins of other body fluids (saliva and urine)
   3886 (KRT35)
  Exosomal proteins of colorectal cancer cells
   3886 (KRT35)
  Exosomal proteins of melanoma cells
   3886 (KRT35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament TPR_MLP1_2 Lzipper-MIP1 Prefoldin_2 DivIC Atg14 Jnk-SapK_ap_N G6PD_N Baculo_PEP_C T6SS_VipA
Motif
Other DBs
NCBI-GeneID: 3886
NCBI-ProteinID: NP_002271
OMIM: 602764
HGNC: 6453
Ensembl: ENSG00000197079
Vega: OTTHUMG00000133425
Pharos: Q92764(Tbio)
UniProt: Q92764
Position
17q21.2
AA seq 455 aa AA seqDB search
MASKCLKAGFSSGSLKSPGGASGGSTRVSAMYSSSSCKLPSLSPVARSFSACSVGLGRSS
YRATSCLPALCLPAGGFATSYSGGGGWFGEGILTGNEKETMQSLNDRLAGYLEKVRQLEQ
ENASLESRIREWCEQQVPYMCPDYQSYFRTIEELQKKTLCSKAENARLVVEIDNAKLAAD
DFRTKYETEVSLRQLVESDINGLRRILDDLTLCKSDLEAQVESLKEELLCLKKNHEEEVN
SLRCQLGDRLNVEVDAAPPVDLNRVLEEMRCQYETLVENNRRDAEDWLDTQSEELNQQVV
SSSEQLQSCQAEIIELRRTVNALEIELQAQHSMRDALESTLAETEARYSSQLAQMQCMIT
NVEAQLAEIRADLERQNQEYQVLLDVRARLECEINTYRGLLESEDSKLPCNPCAPDYSPS
KSCLPCLPAASCGPSAARTNCSPRPICVPCPGGRF
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaatgcctcaaggccggcttctcttctgggtctctcaagagcccaggaggg
gccagtgggggctccactcgtgtgtccgcaatgtactccagcagctcttgcaagcttcca
agtctctcccctgtggccagaagtttctctgcctgctcagtgggtctgggcagaagcagc
tacagggccaccagctgcctccctgctctctgcctccctgctggaggcttcgctaccagc
tacagtgggggtgggggctggtttggggagggcatcctcactggcaatgagaaggagacc
atgcaatccctgaacgaccgcctggccggctacctggagaaggtgcgtcagctggagcag
gagaacgccagcctggagagccgcatccgtgagtggtgtgagcagcaggtcccctacatg
tgccctgactaccagtcctacttccggaccatcgaggagctccagaagaagactctatgc
agcaaggctgagaatgccaggctggtggtggagattgacaatgccaaattggctgcagat
gacttcaggaccaagtatgagacggaggtgtccctgcggcagctggtggagtcagacatc
aacggcctgcgcaggatcctggatgacctgaccctgtgcaagtctgacctggaggcccag
gtggagtccctgaaggaggagctgctctgcctgaagaagaaccatgaggaggaagtgaac
tcactgcgctgccaacttggtgaccgcctcaatgttgaggtggacgctgccccacctgtt
gacctgaaccgagttctggaggagatgaggtgccagtatgaaaccctggtggagaataac
cgccgggatgctgaagactggttggacacccagagtgaggagctgaaccagcaggtggtg
tccagctcagagcagttgcagtcctgccaggcagagatcatcgagctgagacgcacggtc
aacgccctggagattgagctgcaggctcagcacagcatgagagatgctttggaatccacc
ctggcagagacggaggcccgctatagctcccagctggcccagatgcagtgcatgatcacc
aacgtggaggcccagctggccgagatccgggctgacctggagcggcagaaccaggagtac
caggtgctgctggacgtccgggcccggctggagtgtgagatcaacacgtaccggggcctg
ctggagagtgaggacagcaagctcccctgtaacccatgtgcacctgactactcaccctcc
aagtcatgccttccctgtcttcctgcggcctcctgcggtcctagtgcagcccgcacaaac
tgcagcccccgccccatttgtgtgccctgcccagggggtcggttctga

DBGET integrated database retrieval system