KEGG   Homo sapiens (human): 388698Help
Entry
388698            CDS       T01001                                 

Gene name
FLG2, IFPS
Definition
(RefSeq) filaggrin family member 2
  KO
K10384  
filaggrin
Organism
hsa  Homo sapiens (human)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    388698 (FLG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.3
AA seq 2391 aa AA seqDB search
MTDLLRSVVTVIDVFYKYTKQDGECGTLSKGELKELLEKELHPVLKNPDDPDTVDVIMHM
LDRDHDRRLDFTEFLLMIFKLTMACNKVLSKEYCKASGSKKHRRGHRHQEEESETEEDEE
DTPGHKSGYRHSSWSEGEEHGYSSGHSRGTVKCRHGSNSRRLGRQGNLSSSGNQEGSQKR
YHRSSCGHSWSGGKDRHGSSSVELRERINKSHISPSRESGEEYESGSGSNSWERKGHGGL
SCGLETSGHESNSTQSRIREQKLGSSCSGSGDSGRRSHACGYSNSSGCGRPQNASSSCQS
HRFGGQGNQFSYIQSGCQSGIKGGQGHGCVSGGQPSGCGQPESNPCSQSYSQRGYGAREN
GQPQNCGGQWRTGSSQSSCCGQYGSGGSQSCSNGQHEYGSCGRFSNSSSSNEFSKCDQYG
SGSSQSTSFEQHGTGLSQSSGFEQHVCGSGQTCGQHESTSSQSLGYDQHGSSSGKTSGFG
QHGSGSGQSSGFGQCGSGSGQSSGFGQHGSVSGQSSGFGQHGSVSGQSSGFGQHESRSRQ
SSYGQHGSGSSQSSGYGQYGSRETSGFGQHGLGSGQSTGFGQYGSGSGQSSGFGQHGSGS
GQSSGFGQHESRSGQSSYGQHSSGSSQSSGYGQHGSRQTSGFGQHGSGSSQSTGFGQYGS
GSGQSSGFGQHVSGSGQSSGFGQHESRSGHSSYGQHGFGSSQSSGYGQHGSSSGQTSGFG
QHELSSGQSSSFGQHGSGSGQSSGFGQHGSGSGQSSGFGQHESRSGQSSYGQHSSGSSQS
SGYGQHGSRQTSGFGQHGSGSSQSTGFGQYGSGSGQSAGFGQHGSGSGQSSGFGQHESRS
HQSSYGQHGSGSSQSSGYGQHGSSSGQTSGFGQHRSSSGQYSGFGQHGSGSGQSSGFGQH
GTGSGQYSGFGQHESRSHQSSYGQHGSGSSQSSGYGQHGSSSGQTFGFGQHRSGSGQSSG
FGQHGSGSGQSSGFGQHESGSGKSSGFGQHESRSSQSNYGQHGSGSSQSSGYGQHGSSSG
QTTGFGQHRSSSGQYSGFGQHGSGSDQSSGFGQHGTGSGQSSGFGQYESRSRQSSYGQHG
SGSSQSSGYGQHGSNSGQTSGFGQHRPGSGQSSGFGQYGSGSGQSSGFGQHGSGTGKSSG
FAQHEYRSGQSSYGQHGTGSSQSSGCGQHESGSGPTTSFGQHVSGSDNFSSSGQHISDSG
QSTGFGQYGSGSGQSTGLGQGESQQVESGSTVHGRQETTHGQTINTTRHSQSGQGQSTQT
GSRVTRRRRSSQSENSDSEVHSKVSHRHSEHIHTQAGSHYPKSGSTVRRRQGTTHGQRGD
TTRHGHSGHGQSTQTGSRTSGRQRFSHSDATDSEVHSGVSHRPHSQEQTHSQAGSQHGES
ESTVHERHETTYGQTGEATGHGHSGHGQSTQRGSRTTGRRGSGHSESSDSEVHSGGSHRP
QSQEQTHGQAGSQHGESGSTVHGRHGTTHGQTGDTTRHAHYHHGKSTQRGSSTTGRRGSG
HSESSDSEVHSGGSHTHSGHTHGQSGSQHGESESIIHDRHRITHGQTGDTTRHSYSGHEQ
TTQTGSRTTGRQRTSHSESTDSEVHSGGSHRPHSREHTYGQAGSQHEEPEFTVHERHGTT
HGQIGDTTGHSHSGHGQSTQRGSRTTGRQRSSHSESSDSEVHSGVSHTHTGHTHGQAGSQ
HGQSESIVPERHGTTHGQTGDTTRHAHYHHGLTTQTGSRTTGRRGSGHSEYSDSEGYSGV
SHTHSGHTHGQARSQHGESESIVHERHGTIHGQTGDTTRHAHSGHGQSTQTGSRTTGRRS
SGHSEYSDSEGHSGFSQRPHSRGHTHGQAGSQHGESESIVDERHGTTHGQTGDTSGHSQS
GHGQSTQSGSSTTGRRRSGHSESSDSEVHSGGSHTHSGHTHSQARSQHGESESTVHKRHQ
TTHGQTGDTTEHGHPSHGQTIQTGSRTTGRRGSGHSEYSDSEGPSGVSHTHSGHTHGQAG
SHYPESGSSVHERHGTTHGQTADTTRHGHSGHGQSTQRGSRTTGRRASGHSEYSDSEGHS
GVSHTHSGHAHGQAGSQHGESGSSVHERHGTTHGQTGDTTRHAHSGHGQSTQRGSRTAGR
RGSGHSESSDSEVHSGVSHTHSGHTYGQARSQHGESGSAIHGRQGTIHGQTGDTTRHGQS
GHGQSTQTGSRTTGRQRSSHSESSDSEVHSEASPTHSGHTHSQAGSRHGQSGSSGHGRQG
TTHGQTGDTTRHAHYGYGQSTQRGSRTTGRRGSGHSESSDSEVHSWGSHTHSGHIQGQAG
SQQRQPGSTVHGRLETTHGQTGDTTRHGHSGYGQSTQTGSRSSRASHFQSHSSERQRHGS
SQVWKHGSYGPAEYDYGHTGYGPSGGSRKSISNSHLSWSTDSTANKQLSRH
NT seq 7176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctcttgagaagtgttgtcaccgtaattgatgttttctacaaatacaccaag
caagatggggagtgtggcacactgagcaagggtgaactaaaggaacttctggagaaagag
cttcatccagttctgaagaacccagatgatccagacacagtggatgtcatcatgcatatg
ctggatcgagatcatgacagaagattggactttactgagtttcttttgatgatattcaag
ctgactatggcctgcaacaaggtcctcagcaaagaatactgcaaagcttcagggtcaaag
aagcataggcgtggtcaccgacaccaagaagaagaaagtgaaacagaagaggatgaagag
gatacaccaggacataaatcaggttacagacattcaagttggagtgagggagaggagcat
ggatatagttctgggcactcaaggggaactgtgaaatgtagacatgggtccaactccagg
aggctaggaagacaaggtaatttatccagctctgggaaccaagagggatctcagaaaaga
taccacaggtccagctgtggtcattcatggagtggtggcaaagacagacatggttccagc
tctgtagaactgagagaaagaataaacaagtcacacattagcccttctagggaatctggg
gaggagtatgaatctggatctggatcaaacagttgggaaaggaaaggtcatggtggtctg
tcatgtggattggagactagtgggcatgaatcaaactctactcagtcaagaattagagaa
caaaagcttgggtctagctgttcaggttcaggagacagtgggaggcgaagtcatgcatgt
ggttatagcaattcaagtgggtgtggaaggccacaaaatgcttcaagttcttgtcagtca
catagatttggagggcaaggaaatcaatttagctatattcagtcaggctgtcagtcagga
attaagggaggacaaggccatggctgtgtctcaggaggtcagccctctggatgtggtcaa
cctgagtctaacccctgtagtcagtcctatagtcagagaggatatggagctagagaaaat
ggtcaaccacagaactgtggaggacaatggagaacaggctcaagtcagtcctcttgctgt
ggacaatatgggtctggaggtagccagtcttgtagtaatggtcaacatgaatatggttcc
tgtggccgcttttcaaactcttctagttcaaatgaattttccaaatgtgatcaatatggg
tctggttcaagtcagtctactagctttgaacaacatggaacaggcttgagtcagtcctct
gggttcgaacaacatgtatgtggctcaggtcaaacttgtggccagcatgagtctacatca
agtcaatccttgggctatgaccagcatgggtctagctcaggtaagacatctggctttgga
caacatgggtctggctcaggtcagtcctctggctttggacaatgtgggtcaggctcaggt
cagtcctctggctttggacagcatgggtctgtctcaggacaatcctctggttttggacag
catgggtctgtctcaggacaatcctctggttttggacaacatgagtctagatcacgtcag
tctagctatggccaacatggttctggctcaagtcaatcatctggctatggccaatatggg
tctagagagacatctggctttggacaacatgggttgggctcaggtcaatccactggcttt
ggccaatatggatcgggctcaggtcagtcctctggctttggacaacatgggtctggctca
ggacaatcctctggctttggacaacatgagtctagatcaggtcagtctagttatggccaa
cacagttctggctcaagtcagtcatctggctatggccaacatgggtctagacagacatct
ggctttggacaacatgggtcaggctcaagtcaatccactggctttggccaatatggatca
ggctcaggtcagtcctctggctttggacaacatgtttctggctcaggacaatcctctggt
tttggacaacatgagtctagatcaggtcattctagctatggccaacatggttttggctca
agtcaatcatctggctatggtcaacatgggtcaagttcaggacagacatctggatttgga
caacacgagttaagctcaggtcagtcttccagctttggccaacatggatcaggctcaggt
cagtcctctggctttggacaacatgggtctggctcaggacaatcctctggctttggacaa
catgagtctagatcaggtcagtctagctatggccaacacagttctggctcaagtcagtca
tctggctatggccaacatgggtctagacagacatctggctttggacaacatgggtcaggc
tcaagtcaatccactggctttggccaatatggatcaggctcaggtcagtccgctggcttt
ggacaacatgggtctggctcaggacaatcctctggctttggacagcatgagtctagatca
catcagtccagctatggccaacatggttctggctcaagtcaatcatctggctatggtcaa
catgggtcaagttcgggacagacatctggctttggacaacacaggtcaagctcaggtcaa
tactctggctttggacaacatggatcaggctcaggtcagtccagtggctttggacaacat
gggactggctcaggacaatactctggttttggacaacatgagtctagatcacatcagtct
agctatggccaacatggttctggctcaagtcagtcatctggctatggtcaacatgggtca
agttcaggacagacttttggatttggacaacacaggtcaggctcaggtcaatcctctggc
tttggccaacatggatcaggctcaggtcagtcctctggctttggacaacatgagtcaggc
tcaggaaaatcctctggctttggacagcatgagtctagatcaagtcagtctaattatggc
caacatggttctggctcaagtcagtcatctggctatggtcaacatgggtctagttcagga
cagacaactggctttggacaacacaggtcaagctcaggccaatactcaggctttggacaa
catggatcaggctcagatcagtcctctggctttggacaacatgggactggttcaggacaa
tcctctggttttggacaatatgagtctagatcacgtcagtctagctatggccaacatggt
tctggctcaagtcaatcatctggctatggtcaacatgggtcaaattcaggacagacatct
ggatttggacaacacaggccaggctcaggtcagtcctctggctttggccaatatggatcg
ggctcaggtcagtcttctggctttggacaacatgggtcaggcacaggtaaatcctctggc
tttgcacagcatgagtacagatcaggtcagtctagctatggccaacatggtactggctcc
agtcaatcatctggctgtggccaacatgagtctggctcaggtccaaccacaagttttgga
cagcatgtgtctggctcagacaatttctctagttctggacaacatatatctgactcaggt
cagtccactggatttggccaatatggttcaggctcaggtcaatcaactggcttgggccag
ggtgaatctcaacaagtagagtcaggatccacagttcatgggagacaggaaactactcat
ggtcagacaataaataccactagacatagccagtctggtcaaggacaatccacacagaca
gggtccagggtaactagaagacgaagatctagccaaagtgagaacagtgacagtgaagtg
cactcaaaggtctcacacagacattcagaacacattcacacacaagctggatctcactac
ccaaagtcaggatccacagttcgcagaagacaaggaactactcatggacagagaggagat
accactagacatggccattctggtcatggacagtctacacagacaggttccagaacatct
ggaagacagagatttagccacagtgatgccactgacagtgaagtgcactcaggggtctca
catagaccacactcacaagaacaaactcacagccaagctggatctcaacatggagagtca
gaatccacagttcatgagagacatgaaactacttatggacagacaggagaggccactgga
catggccactctggtcatggacagtccacacagagagggtccaggacaactggaagaagg
ggatctggccatagtgagtccagtgacagtgaagtgcactcagggggctcacacagacca
caatcacaagaacaaactcatggccaagccggatctcaacatggagagtcaggatccaca
gttcatgggagacacggaactactcatggacagacaggagataccactagacatgcccac
tatcatcatggaaaatccacacagagagggtccagtacaactggaagaaggggatctggc
cacagtgagtccagtgacagtgaagtgcactcagggggctcgcacacacattcaggacac
actcacggccaaagtggatctcaacatggagagtcagaatccataattcatgacagacac
agaattactcatggacagacaggagataccactagacattcctactctggtcatgaacaa
accacacagacagggtccaggacaactggaagacagagaactagccacagtgagtccact
gacagtgaagtgcactcagggggctcacacagaccacactcacgagaacacacttacggc
caagccggatctcaacatgaagagccagaattcacagttcatgagagacacggaactact
catggacagataggagataccactggacattcccactctggtcatggacagtccacacag
agagggtccaggacaactggaagacagagatctagccacagtgagtccagtgacagtgaa
gtgcactcaggggtctcacacacacatacaggacacactcatggtcaagctggatctcaa
catggacagtcagaatccatagttcctgagagacatggaactactcatggacagacagga
gataccactagacatgcccactatcatcatggattaaccacacagacagggtccaggact
actggaagaaggggatctggccacagtgagtacagtgacagtgaagggtactcaggagtc
tcacatacacattcaggacacactcatggccaagccagatctcaacatggagagtcagaa
tccatagttcatgagagacatggaactatacatggacagacaggcgataccaccagacat
gcccactctggtcatggacagtccacacagacagggtccaggaccactggaagaaggtca
tctggccacagtgagtacagtgacagtgaagggcactcagggttctcacaaagaccacac
tcacgaggacacactcacggccaggctggatctcaacatggagagtcagaatccatagtt
gacgagagacatggaactactcatggacagacaggagataccagtggacattctcaatct
ggtcatggacagtccacacagtcaggatccagtacaactggaagaaggagatctggccac
agtgagtccagtgacagtgaagtgcactcagggggctcacatacacattcaggacacaca
cacagccaagccaggtctcaacatggagagtcagaatccacagttcacaagagacaccaa
actactcatggacagacaggagataccactgaacatggccaccctagtcatggacaaacc
atacagacagggtccaggacaactggaagaaggggatctggccacagtgagtacagtgac
agtgaagggccctcaggggtctcacacacacattcaggacacactcacggtcaagctgga
tctcactatccagagtcaggatcctcagttcatgagagacacggaactactcatggacaa
acagcagataccactagacatggccactctggtcatggacagtccacacagagagggtcc
aggacaactggaagaagggcatctggccacagtgagtacagtgacagtgaagggcactca
ggggtctcacacacacattcaggacacgctcatggccaagccggatctcaacatggagag
tcaggatcctcagttcatgagagacacggaactactcatggacagacaggagataccact
agacatgctcactctggtcatggacagtccacacagagagggtcaaggacagctggaaga
aggggatctggccacagtgagtccagtgacagtgaagtgcactcaggggtctcacacaca
cattcaggacacacttatggccaagccagatctcaacatggagagtcaggatctgccatt
cacgggagacagggaactatacatggacagacaggagataccactagacatggccagtct
ggtcatggacagtccacacagacaggttccaggacaactggaagacaaagatctagtcac
agtgagtccagtgatagtgaagtgcactcagaggcctcacccacacattcaggacacact
cacagccaagccggatctcgacatggacagtcaggatcctcaggtcatgggagacaggga
actactcatggacagacaggagataccactagacatgcccactatggttatggacaatcc
acacagagagggtccaggacaactggaagaaggggatctggccacagtgagtccagtgac
agtgaagtgcactcatggggctcacacacacattcaggacacattcagggccaagctgga
tctcaacaaagacagccaggatccacagttcatgggagactggaaactactcatggacag
acaggagataccactagacatggccattctggttatggacaatccacacagacaggttcc
agatctagtagagcaagtcattttcagtcacatagtagtgaaaggcaaaggcatggatca
agtcaggtttggaaacatggcagctatggacctgcagaatatgactatgggcacactggg
tatgggccttctggtggcagcagaaaaagcatcagtaattctcacctttcatggtcaaca
gacagcactgcaaacaagcaactgtctagacattga

DBGET integrated database retrieval system