KEGG   Homo sapiens (human): 3895Help
Entry
3895              CDS       T01001                                 

Gene name
KTN1, CG1, KNT, MU-RMS-40.19
Definition
(RefSeq) kinectin 1
  KO
K17975  
kinectin
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Mitochondrial movement
    3895 (KTN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q22.1
AA seq 1357 aa AA seqDB search
MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKK
KNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPVPLNVVETSSSVRERKKKEKK
QKPVLEEQVIKESDASKIPGKKVEPVPVTKQPTPPSEAAASKKKPGQKKSKNGSDDQDKK
VETLMVPSKRQEALPLHQETKQESGSGKKKASSKKQKTENVFVDEPLIHATTYIPLMDNA
DSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENAEVKFKDFLLSLKTMMFSEDE
ALCVVDLLKEKSGVIQDALKKSSKGELTTLIHQLQEKDKLLAAVKEDAAATKDRCKQLTQ
EMMTEKERSNVVITRMKDRIGTLEKEHNVFQNKIHVSYQETQQMQMKFQQVREQMEAEIA
HLKQENGILRDAVSNTTNQLESKQSAELNKLRQDYARLVNELTEKTGKLQQEEVQKKNAE
QAATQLKVQLQEAERRWEEVQSYIRKRTAEHEAAQQDLQSKFVAKENEVQSLHSKLTDTL
VSKQQLEQRLMQLMESEQKRVNKEESLQMQVQDILEQNEALKAQIQQFHSQIAAQTSASV
LAEELHKVIAEKDKQIKQTEDSLASERDRLTSKEEELKDIQNMNFLLKAEVQKLQALANE
QAAAAHELEKMQQSVYVKDDKIRLLEEQLQHEISNKMEEFKILNDQNKALKSEVQKLQTL
VSEQPNKDVVEQMEKCIQEKDEKLKTVEELLETGLIQVATKEEELNAIRTENSSLTKEVQ
DLKAKQNDQVSFASLVEELKKVIHEKDGKIKSVEELLEAELLKVANKEKTVQDLKQEIKA
LKEEIGNVQLEKAQQLSITSKVQELQNLLKGKEEQMNTMKAVLEEKEKDLANTGKWLQDL
QEENESLKAHVQEVAQHNLKEASSASQFEELEIVLKEKENELKRLEAMLKERESDLSSKT
QLLQDVQDENKLFKSQIEQLKQQNYQQASSFPPHEELLKVISEREKEISGLWNELDSLKD
AVEHQRKKNNDLREKNWEAMEALASTEKMLQDKVNKTSKERQQQVEAVELEAKEVLKKLF
PKVSVPSNLSYGEWLHGFEKKAKECMAGTSGSEEVKVLEHKLKEADEMHTLLQLECEKYK
SVLAETEGILQKLQRSVEQEENKWKVKVDESHKTIKQMQSSFTSSEQELERLRSENKDIE
NLRREREHLEMELEKAEMERSTYVTEVRELKDLLTELQKKLDDSYSEAVRQNEELNLLKA
QLNETLTKLRTEQNERQKVAGDLHKAQQSLELIQSKIVKAAGDTTVIENSDVSPETESSE
KETMSVSLNQTVTQLQQLLQAVNQQLTKEKEHYQVLE
NT seq 4074 nt NT seq  +upstreamnt  +downstreamnt
atggagttttatgagtcagcatattttattgttcttattccttcaatagttattacagta
attttcctcttcttctggcttttcatgaaagaaacattatatgatgaagttcttgcaaaa
cagaaaagagaacaaaagcttattcctaccaaaacagataaaaagaaagcagaaaagaaa
aagaataaaaagaaagaaatccagaatggaaacctccatgaatccgactctgagagtgta
cctcgagactttaaattatcagatgctttggcagtagaagatgatcaagttgcacctgtt
ccattgaatgtcgttgaaacttcaagtagtgttagggaaagaaaaaagaaggaaaagaaa
caaaagcctgtgcttgaagagcaggtcatcaaagaaagtgacgcatcaaagattcctggc
aaaaaagtagaacctgtcccagttactaaacagcccacccctccctctgaagcagctgcc
tcgaagaagaaaccagggcagaagaagtctaaaaatggaagcgatgaccaggataaaaag
gtggaaactctcatggtaccatcaaaaaggcaagaagcattgcccctccaccaagagact
aaacaagaaagtggatcagggaagaagaaagcttcatcaaagaaacaaaagacagaaaat
gtcttcgtagatgaaccccttattcatgcaactacttatattcctttgatggataatgct
gactcaagtcctgtggtagataagagagaggttattgatttgcttaaacctgaccaagta
gaagggatccagaaatctgggactaaaaaactgaagaccgaaactgacaaagaaaatgct
gaagtgaagtttaaagattttcttctgtccttgaagactatgatgttttctgaagatgag
gctctttgtgttgtagacttgctaaaggagaagtctggtgtaatacaagatgctttaaag
aagtcaagtaagggagaattgactacgcttatacatcagcttcaagaaaaggacaagtta
ctcgctgctgtgaaggaagatgctgctgctacaaaggatcggtgtaagcagttaacccag
gaaatgatgacagagaaagaaagaagcaatgtggttataacaaggatgaaagatcgaatt
ggaacattagaaaaggaacataatgtatttcaaaacaaaatacatgtcagttatcaagag
actcaacagatgcagatgaagtttcagcaagttcgtgagcagatggaggcagagatagct
cacttgaagcaggaaaatggtatactgagagatgcagtcagcaacactacaaatcaactg
gaaagcaagcagtctgcagaactaaataaactacgccaggattatgctaggttggtgaat
gagctgactgagaaaacaggaaagctacagcaagaggaagtccaaaagaagaatgctgag
caagcagctactcagttgaaggttcaactacaagaagctgagagaaggtgggaagaagtt
cagagctacatcaggaagagaacagcggaacatgaggcagcacagcaagatttacagagt
aaatttgtggccaaagaaaatgaagtacagagtctgcatagtaagcttacagataccttg
gtatcaaaacaacagttggagcaaagactaatgcagttaatggaatcagagcagaaaagg
gtgaacaaagaagagtctctacaaatgcaggttcaggatattttggagcagaatgaggct
ttgaaagctcaaattcagcagttccattcccagatagcagcccagacctccgcttcagtt
ctagcagaagaattacataaagtgattgcagaaaaggataagcagataaaacagactgaa
gattctttagcaagtgaacgtgatcgtttaacaagtaaagaagaggaacttaaggatata
cagaatatgaatttcttattaaaagctgaagtgcagaaattacaggccctggcaaatgag
caggctgctgctgcacatgaattggagaagatgcaacaaagtgtttatgttaaagatgat
aaaataagattgctggaagagcaactacaacatgaaatttcaaacaaaatggaagaattt
aagattctaaatgaccaaaacaaagcattaaaatcagaagttcagaagctacagactctt
gtttctgaacagcctaataaggatgttgtggaacaaatggaaaaatgcattcaagaaaaa
gatgagaagttaaagactgtggaagaattacttgaaactggacttattcaggtggcaact
aaagaagaggagctgaatgcaataagaacagaaaattcatctctgacaaaagaagttcaa
gacttaaaagctaagcaaaatgatcaggtttcttttgcctctctagttgaagaacttaag
aaagtgatccatgagaaagatggaaagatcaagtctgtagaagagcttctggaggcagaa
cttctcaaagttgctaacaaggagaaaactgttcaggatttgaaacaggaaataaaggct
ctaaaagaagaaataggaaatgtccagcttgaaaaggctcaacagttatctatcacttcc
aaagttcaggagcttcagaacttattaaaaggaaaagaggaacagatgaataccatgaag
gctgttttggaagagaaagagaaagacctagccaatacagggaagtggttacaggatctt
caagaagaaaatgaatctttaaaagcacatgttcaggaagtagcacaacataacttgaaa
gaggcctcttctgcatcacagtttgaagaacttgagattgtgttgaaagaaaaggaaaat
gaattgaagaggttagaagccatgctaaaagagagggagagtgatctttctagcaaaaca
cagctgttacaggatgtacaagatgaaaacaaattgtttaagtcccaaattgagcagctt
aaacaacaaaactaccaacaggcatcttcttttccccctcatgaagaattattaaaagta
atttcagaaagagagaaagaaataagtggtctctggaatgagttagattctttgaaggat
gcagttgaacaccagaggaagaaaaacaatgaccttcgggagaaaaactgggaagcaatg
gaagcattggcatcaactgaaaaaatgctgcaggacaaagtgaacaagacttccaaggaa
aggcagcaacaggtggaagctgttgagttggaggctaaagaagttctcaaaaaattattt
ccaaaggtgtctgtcccttctaatttgagttatggtgaatggttgcatggatttgaaaaa
aaggcaaaagaatgtatggctggaacttcagggtcagaggaggttaaggttctagagcac
aagttgaaagaagctgatgaaatgcacacattgttacagctagagtgtgaaaaatacaaa
tccgtccttgcagaaacagaaggaattttacagaagctacagagaagtgttgagcaagaa
gaaaataaatggaaagttaaggtcgatgaatcacacaagactattaaacagatgcagtca
tcatttacatcttcagaacaagagctagagcgattaagaagcgaaaataaggatattgaa
aatctgagaagagaacgagaacatttggaaatggaactagaaaaggcagagatggaacga
tctacctatgttacagaagtcagagagctgaaagatctgttgactgaattgcagaaaaaa
cttgatgattcatattctgaagcagtaagacagaatgaagagctaaatttgttgaaggca
cagttaaatgaaacactcacaaaacttagaactgaacaaaatgaaagacagaaggtagct
ggtgatttgcataaggctcaacagtcactggagcttatccagtcaaaaatagtaaaagct
gctggagacactactgttattgaaaatagtgatgtttccccagaaacggagtcttctgag
aaggagacaatgtctgtaagtctaaatcagactgtaacacagttacagcagttgcttcag
gcggtaaaccaacagctcacaaaggagaaagagcactaccaggtgttagagtga

DBGET integrated database retrieval system