KEGG   Homo sapiens (human): 3897Help
Entry
3897              CDS       T01001                                 

Gene name
L1CAM, CAML1, CD171, HSAS, HSAS1, MASA, MIC5, N-CAM-L1, N-CAML1, NCAM-L1, S10, SPG1
Definition
L1 cell adhesion molecule
Orthology
K06550  
L1 cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Cell adhesion molecules (CAMs)
Disease
H00266  
Hereditary spastic paraplegia (SPG)
H00577  
Syndromic X-linked mental retardation with epilepsy or seizures
H01034  
L1 syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3897 (L1CAM)
 Organismal Systems
  Development
   04360 Axon guidance
    3897 (L1CAM)
Cellular antigens [BR:hsa04090]
 Proteins
  3897 (L1CAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 1257 aa AA seqDB search
MVVALRYVWPLLLCSPCLLIQIPEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEAS
GKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKL
GTAMSHEIRLMAEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNSKILHIK
QDERVTMGQNGNLYFANVLTSDNHSDYICHAHFPGTRTIIQKEPIDLRVKATNSMIDRKP
RLLFPTNSSSHLVALQGQPLVLECIAEGFPTPTIKWLRPSGPMPADRVTYQNHNKTLQLL
KVGEEDDGEYRCLAENSLGSARHAYYVTVEAAPYWLHKPQSHLYGPGETARLDCQVQGRP
QPEVTWRINGIPVEELAKDQKYRIQRGALILSNVQPSDTMVTQCEARNRHGLLLANAYIY
VVQLPAKILTADNQTYMAVQGSTAYLLCKAFGAPVPSVQWLDEDGTTVLQDERFFPYANG
TLGIRDLQANDTGRYFCLAANDQNNVTIMANLKVKDATQITQGPRSTIEKKGSRVTFTCQ
ASFDPSLQPSITWRGDGRDLQELGDSDKYFIEDGRLVIHSLDYSDQGNYSCVASTELDVV
ESRAQLLVVGSPGPVPRLVLSDLHLLTQSQVRVSWSPAEDHNAPIEKYDIEFEDKEMAPE
KWYSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNPVD
VKGEGNETTNMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPWQEQIVSDPFLVVSNTST
FVPYEIKVQAVNSQGKGPEPQVTIGYSGEDYPQAIPELEGIEILNSSAVLVKWRPVDLAQ
VKGHLRGYNVTYWREGSQRKHSKRHIHKDHVVVPANTTSVILSGLRPYSSYHLEVQAFNG
RGSGPASEFTFSTPEGVPGHPEALHLECQSNTSLLLRWQPPLSHNGVLTGYVLSYHPLDE
GGKGQLSFNLRDPELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDF
GNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDL
QPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATEGWFIGFVSAIILLLLVLLIL
CFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGSSQPSLNGDIK
PLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtggcgctgcggtacgtgtggcctctcctcctctgcagcccctgcctgcttatc
cagatccccgaggaatatgaaggacaccatgtgatggagccacctgtcatcacggaacag
tctccacggcgcctggttgtcttccccacagatgacatcagcctcaagtgtgaggccagt
ggcaagcccgaagtgcagttccgctggacgagggatggtgtccacttcaaacccaaggaa
gagctgggtgtgaccgtgtaccagtcgccccactctggctccttcaccatcacgggcaac
aacagcaactttgctcagaggttccagggcatctaccgctgctttgccagcaataagctg
ggcaccgccatgtcccatgagatccggctcatggccgagggtgcccccaagtggccaaag
gagacagtgaagcccgtggaggtggaggaaggggagtcagtggttctgccttgcaaccct
cccccaagtgcagagcctctccggatctactggatgaacagcaagatcttgcacatcaag
caggacgagcgggtgacgatgggccagaacggcaacctctactttgccaatgtgctcacc
tccgacaaccactcagactacatctgccacgcccacttcccaggcaccaggaccatcatt
cagaaggaacccattgacctccgggtcaaggccaccaacagcatgattgacaggaagccg
cgcctgctcttccccaccaactccagcagccacctggtggccttgcaggggcagccattg
gtcctggagtgcatcgccgagggctttcccacgcccaccatcaaatggctgcgccccagt
ggccccatgccagccgaccgtgtcacctaccagaaccacaacaagaccctgcagctgctg
aaagtgggcgaggaggatgatggcgagtaccgctgcctggccgagaactcactgggcagt
gcccggcatgcgtactatgtcaccgtggaggctgccccgtactggctgcacaagccccag
agccatctatatgggccaggagagactgcccgcctggactgccaagtccagggcaggccc
caaccagaggtcacctggagaatcaacgggatccctgtggaggagctggccaaagaccag
aagtaccggattcagcgtggcgccctgatcctgagcaacgtgcagcccagtgacacaatg
gtgacccaatgtgaggcccgcaaccggcacgggctcttgctggccaatgcctacatctac
gttgtccagctgccagccaagatcctgactgcggacaatcagacgtacatggctgtccag
ggcagcactgcctaccttctgtgcaaggccttcggagcgcctgtgcccagtgttcagtgg
ctggacgaggatgggacaacagtgcttcaggacgaacgcttcttcccctatgccaatggg
accctgggcattcgagacctccaggccaatgacaccggacgctacttctgcctggctgcc
aatgaccaaaacaatgttaccatcatggctaacctgaaggttaaagatgcaactcagatc
actcaggggccccgcagcacaatcgagaagaaaggttccagggtgaccttcacgtgccag
gcctcctttgacccctccttgcagcccagcatcacctggcgtggggacggtcgagacctc
caggagcttggggacagtgacaagtacttcatagaggatgggcgcctggtcatccacagc
ctggactacagcgaccagggcaactacagctgcgtggccagtaccgaactggatgtggtg
gagagtagggcacagctcttggtggtggggagccctgggccggtgccacggctggtgctg
tccgacctgcacctgctgacgcagagccaggtgcgcgtgtcctggagtcctgcagaagac
cacaatgcccccattgagaaatatgacattgaatttgaggacaaggaaatggcgcctgaa
aaatggtacagtctgggcaaggttccagggaaccagacctctaccaccctcaagctgtcg
ccctatgtccactacacctttagggttactgccataaacaaatatggccccggggagccc
agcccggtctctgagactgtggtcacacctgaggcagccccagagaagaaccctgtggat
gtgaagggggaaggaaatgagaccaccaatatggtcatcacgtggaagccgctccggtgg
atggactggaacgccccccaggttcagtaccgcgtgcagtggcgccctcaggggacacga
gggccctggcaggagcagattgtcagcgaccccttcctggtggtgtccaacacgtccacc
ttcgtgccctatgagatcaaagtccaggccgtcaacagccagggcaagggaccagagccc
caggtcactatcggctactctggagaggactacccccaggcaatccctgagctggaaggc
attgaaatcctcaactcaagtgccgtgctggtcaagtggcggccggtggacctggcccag
gtcaagggccacctccgcggatacaatgtgacgtactggagggagggcagtcagaggaag
cacagcaagagacatatccacaaagaccatgtggtggtgcccgccaacaccaccagtgtc
atcctcagtggcttgcggccctatagctcctaccacctggaggtgcaggcctttaacggg
cgaggatcggggcccgccagcgagttcaccttcagcaccccagagggagtgcctggccac
cccgaggcgttgcacctggagtgccagtcgaacaccagcctgctgctgcgctggcagccc
ccactcagccacaacggcgtgctcaccggctacgtgctctcctaccaccccctggatgag
gggggcaaggggcaactgtccttcaaccttcgggaccccgaacttcggacacacaacctg
accgatctcagcccccacctgcggtaccgcttccagcttcaggccaccaccaaagagggc
cctggtgaagccatcgtacgggaaggaggcactatggccttgtctgggatctcagatttt
ggcaacatctcagccacagcgggtgaaaactacagtgtcgtctcctgggtccccaaggag
ggccagtgcaacttcaggttccatatcttgttcaaagccttgggagaagagaagggtggg
gcttccctttcgccacagtatgtcagctacaaccagagctcctacacgcagtgggacctg
cagcctgacactgactacgagatccacttgtttaaggagaggatgttccggcaccaaatg
gctgtgaagaccaatggcacaggccgcgtgaggctccctcctgctggcttcgccactgag
ggctggttcatcggctttgtgagtgccatcatcctcctgctcctcgtcctgctcatcctc
tgcttcatcaagcgcagcaagggcggcaaatactcagtgaaggataaggaggacacccag
gtggactctgaggcccgaccgatgaaagatgagaccttcggcgagtacaggtccctggag
agtgacaacgaggagaaggcctttggcagcagccagccatcgctcaacggggacatcaag
cccctgggcagtgacgacagcctggccgattatgggggcagcgtggatgttcagttcaac
gaggatggttcgttcattggccagtacagtggcaagaaggagaaggaggcggcagggggc
aatgacagctcaggggccacttcccccatcaaccctgccgtggccctagaatag

DBGET integrated database retrieval system