KEGG   Homo sapiens (human): 389852Help
Entry
389852            CDS       T01001                                 

Gene name
SPACA5, LYC5, LYZL5, PNPK6288, SLLP-X, SLLP2, UNQ6288
Definition
sperm acrosome associated 5 (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     389852 (SPACA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
Xp11.23
AA seq 159 aa AA seqDB search
MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFD
TAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVS
SQNGLSAWTSWRLHCSGHDLSEWLKGCDMHVKIDPKIHP
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctggggcactgtggtagtgaccttggccacgctgatggttgtcactgtggat
gccaagatctatgaacgctgcgagctggcggcaagactggagagagcagggctgaacggc
tacaagggctacggcgttggagactggctgtgcatggctcattatgagagtggctttgac
accgccttcgtggaccacaatcctgatggcagcagtgaatatggcattttccaactgaat
tctgcctggtggtgtgacaatggcattacacccaccaagaacctctgccacatggattgt
catgacctgctcaatcgccatattctggatgacatcaggtgtgccaagcagattgtgtcc
tcacagaatgggctttctgcctggacttcttggaggctacactgttctggccatgattta
tctgaatggctcaaggggtgtgatatgcatgtgaaaattgatccaaaaattcatccatga

DBGET integrated database retrieval system