KEGG   Homo sapiens (human): 389856Help
Entry
389856            CDS       T01001                                 

Gene name
USP27X, USP22L, USP27
Definition
ubiquitin specific peptidase 27, X-linked (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     389856 (USP27X)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   389856 (USP27X)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     389856 (USP27X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.23
AA seq 438 aa AA seqDB search
MCKDYVYDKDIEQIAKEEQGEALKLQASTSTEVSHQQCSVPGLGEKFPTWETTKPELELL
GHNPRRRRITSSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPEL
CLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHC
KGDDVGKAANNPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSF
WPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMN
KLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGNN
ENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHK
QVLEHESEKVKEMNTQAY
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaggactatgtatatgacaaagacattgagcaaattgccaaagaagagcaagga
gaagctttgaaattacaagcctccacctcaacagaggtttctcaccagcagtgttcagtg
ccaggccttggtgagaaattcccaacctgggaaacaaccaaaccagaattagaactgctg
gggcacaacccgaggagaagaagaatcacctccagctttacgatcggtttaagaggactc
atcaatcttggcaacacgtgctttatgaactgcattgtccaggccctcacccacacgccg
atactgagagatttctttctctctgacaggcaccgatgtgagatgccgagtcccgagttg
tgtctggtctgtgagatgtcgtcgctgtttcgggagttgtattctggaaacccgtctcct
catgtgccctataagttactgcacctggtgtggatacatgcccgccatttagcagggtac
aggcaacaggatgcccacgagttcctcattgcagcgttagatgtcctgcacaggcactgc
aaaggtgatgatgtcgggaaggcggccaacaatcccaaccactgtaactgcatcatagac
caaatcttcacaggtggcctgcagtctgatgtcacctgtcaagcctgccatggcgtctcc
accacgatagacccatgctgggacattagtttggacttgcctggctcttgcacctccttc
tggcccatgagcccagggagggagagcagtgtgaacggggaaagccacataccaggaatc
accaccctcacggactgcttgcggaggtttacgaggccagagcacttaggaagcagtgcc
aaaatcaaatgtggtagttgccaaagctaccaggaatctaccaaacagctcacaatgaat
aaattacctgtcgttgcctgttttcatttcaaacggtttgaacattcagcgaaacagagg
cgcaagatcactacatacatttcctttcctctggagctggatatgacgccgtttatggcc
tcaagtaaagagagcagaatgaatggacaattgcagctgccaaccaatagtggaaacaac
gaaaataagtattccttgtttgctgtggttaatcaccaaggaaccttggagagtggccac
tataccagcttcatccggcaccacaaggaccagtggttcaagtgtgatgatgccgtcatc
actaaggccagtattaaggacgtactggacagtgaagggtatttactgttctatcacaaa
caggtgctagaacatgagtcagaaaaagtgaaagaaatgaacacacaagcctactga

DBGET integrated database retrieval system