KEGG   Homo sapiens (human): 390Help
Entry
390               CDS       T01001                                 

Gene name
RND3, ARHE, Rho8, RhoE, memB
Definition
(RefSeq) Rho family GTPase 3
  KO
K07859  
Rho family GTPase 3
Organism
hsa  Homo sapiens (human)
Brite
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rnd [OT]
    390 (RND3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q23.3
AA seq 244 aa AA seqDB search
MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENY
TASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGE
IQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSAL
QSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKS
CTVM
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagagaagagccagccagaaattatccagcaaatctatcatggatcctaatcag
aacgtgaaatgcaagatagttgtggtgggagacagtcagtgtggaaaaactgcgctgctc
catgtcttcgccaaggactgcttccccgagaattacgttcctacagtgtttgagaattac
acggccagttttgaaatcgacacacaaagaatagagttgagcctgtgggacacttcgggt
tctccttactatgacaatgtccgccccctctcttaccctgattcggatgctgtgctgatt
tgctttgacatcagtagaccagagaccctggacagtgtcctcaaaaagtggaaaggtgaa
atccaggaattttgtccaaataccaaaatgctcttggtcggctgcaagtctgatctgcgg
acagatgttagtacattagtagagctctccaatcacaggcagacgccagtgtcctatgac
cagggggcaaatatggccaaacagattggagcagctacttatatcgaatgctcagcttta
cagtcggaaaatagcgtcagagacatttttcacgttgccaccttggcatgtgtaaataag
acaaataaaaacgttaagcggaacaaatcacagagagccacaaagcggatttcacacatg
cctagcagaccagaactctcggcagttgctacggacttacgaaaggacaaagcgaagagc
tgcactgtgatgtga

DBGET integrated database retrieval system