KEGG   Homo sapiens (human): 390037Help
Entry
390037            CDS       T01001                                 

Gene name
OR52I1, OR11-13
Definition
(RefSeq) olfactory receptor family 52 subfamily I member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390037 (OR52I1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390037 (OR52I1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 390037
NCBI-ProteinID: NP_001005169
HGNC: 15220
Ensembl: ENSG00000232268
Vega: OTTHUMG00000165722
Pharos: Q8NGK6(Tdark)
UniProt: Q8NGK6
Position
11p15.4
AA seq 324 aa AA seqDB search
MLGPAYNHTMETPASFLLVGIPGLQSSHLWLAISLSAMYITALLGNTLIVTAIWMDSTRH
EPMYCFLCVLAAVDIVMASSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLL
TMAFDRYVAICKPLHYKRILTPQVMLGMSMAVTIRAVTFMTPLSWMMNHLPFCGSNVVVH
SYCKHIALARLACADPVPSSLYSLIGSSLMVGSDVAFIAASYILILRAVFDLSSKTAQLK
ALSTCGSHVGVMALYYLPGMASIYAAWLGQDIVPLHTQVLLADLYVIIPATLNPIIYGMR
TKQLLEGIWSYLMHFLFDHSNLGS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtccagcttacaaccacacaatggaaacccctgcctccttcctccttgtgggt
atcccaggactgcaatcttcacatctttggctggctatctcactgagtgccatgtacatc
acagccctgttaggaaacaccctcatcgtgactgcaatctggatggattccactcggcat
gagcccatgtattgctttctgtgtgttctggctgctgtggacattgttatggcctcctcc
gtggtacccaagatggtgagcatcttctgctcgggagacagctccatcagctttagtgct
tgtttcactcagatgttttttgtccacttagccacagctgtggagacggggctgctgctg
accatggcttttgaccgctatgtagccatctgcaagcctctacactacaagagaattctc
acgcctcaagtgatgctgggaatgagtatggccgtcaccatcagagctgtcacattcatg
actccactgagttggatgatgaatcatctacctttctgtggctccaatgtggttgtccac
tcctactgtaagcacatagctttggccaggttagcatgtgctgaccccgtgcccagcagt
ctctacagtctgattggttcctctcttatggtgggctctgatgtggccttcattgctgcc
tcctatatcttaattctcagggcagtatttgatctctcctcaaagactgctcagttgaaa
gcattaagcacatgtggctcccatgtgggggttatggctttgtactatctacctgggatg
gcatccatctatgcggcctggttggggcaggatatagtgcccttgcacacccaagtgctg
ctagctgacctgtacgtgatcatcccagccactttaaatcccatcatctatggcatgagg
accaaacaattgctggagggaatatggagttatctgatgcacttcctctttgaccactcc
aacctgggttcatga

DBGET integrated database retrieval system