KEGG   Homo sapiens (human): 390059Help
Entry
390059            CDS       T01001                                 

Gene name
OR51M1, HOR5'Beta7, OR11-40
Definition
(RefSeq) olfactory receptor family 51 subfamily M member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390059 (OR51M1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390059 (OR51M1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390059
NCBI-ProteinID: NP_001004756
HGNC: 14847
Ensembl: ENSG00000184698
Vega: OTTHUMG00000066680
Pharos: Q9H341(Tdark)
UniProt: Q9H341 B2RNI9
Position
11p15.4
AA seq 326 aa AA seqDB search
MSVQYSLSPQFMLLSNITQFSPIFYLTSFPGLEGIKHWIFIPFFFMYMVAISGNCFILII
IKTNPRLHTPMYYLLSLLALTDLGLCVSTLPTTMGIFWFNSHSIYFGACQIQMFCIHSFS
FMESSVLLMMSFDRLVAICHPLRYSVIITGQQVVRAGLIVIFRGPVATIPIVLLLKAFPY
CGSVVLSHSFCLHQEVIQLACTDITFNNLYGLMVVVFTVMLDLVLIALSYGLILHTVAGL
ASQEEQRRAFQTCTAPLCAVLVFFVPMMGLSLVHRFGKHAPPAIHLLMANVYLFVPPMLN
PIIYSIKTKEIHRAIIKFLGLKKASK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtccaatattcgctcagtcctcaattcatgctgctatccaacattactcagttt
agccccatattctatctcaccagctttcctggattggaaggcatcaaacactggattttc
atcccctttttctttatgtacatggttgccatctcaggcaattgtttcattctgatcatt
attaagaccaaccctcgtctgcacacacccatgtactatctactatccttgctggccctc
actgacctggggctgtgtgtgtccacgttgcccaccactatggggatcttctggtttaac
tcccatagtatctactttggagcgtgtcaaatccagatgttctgcatccactctttttcc
ttcatggagtcctcagtgctcctcatgatgtcctttgaccgccttgtggccatctgccac
cctctgaggtattcggtcattatcactggccagcaagtggtcagagcaggcctaattgtc
atcttccggggacctgtggccactatccctattgtcctcctcctgaaggcttttccctac
tgtggatctgtggtcctctcccactcattttgcctgcaccaggaagtgatacagctggcc
tgcacagatatcaccttcaataatctgtatggactgatggtggtagttttcactgtgatg
ctggacctggtgctcatcgcactgtcctatggactcatcctgcacacagtagcaggcctg
gcctcccaagaggagcagcgccgtgcctttcagacatgcaccgctcctctctgtgctgtg
ctagtattctttgtgcccatgatggggctgtccctggtgcaccgttttgggaagcatgcc
ccacctgctattcatcttcttatggccaatgtctacctttttgtgcctcccatgcttaac
ccaatcatatacagcattaagaccaaggagatccaccgtgccattatcaagttcctaggt
cttaaaaaggccagtaaatga

DBGET integrated database retrieval system