KEGG   Homo sapiens (human): 390064Help
Entry
390064            CDS       T01001                                 

Gene name
OR51I2, OR11-38
Definition
olfactory receptor, family 51, subfamily I, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390064 (OR51I2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390064 (OR51I2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 312 aa AA seqDB search
MGLFNVTHPAFFLLTGIPGLESSHSWLSGPLCVMYAVALGGNTVILQAVRVEPSLHEPMY
YFLSMLSFSDVAISMATLPTVLRTFCLNARNITFDACLIQMFLIHFFSMMESGILLAMSF
DRYVAICDPLRYATVLTTEVIAAMGLGAAARSFITLFPLPFLIKRLPICRSNVLSHSYCL
HPDMMRLACADISINSIYGLFVLVSTFGMDLFFIFLSYVLILRSVMATASREERLKALNT
CVSHILAVLAFYVPMIGVSTVHRFGKHVPCYIHVLMSNVYLFVPPVLNPLIYSAKTKEIR
RAIFRMFHHIKI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggggttgttcaatgtcactcaccctgcattcttcctcctgactggtatccctggtctg
gagagctctcactcctggctgtcagggcccctctgcgtgatgtatgctgtggcccttggg
ggaaatacagtgatcctgcaggctgtgcgagtggagcccagcctccatgagcccatgtac
tacttcctgtccatgttgtccttcagtgatgtggccatatccatggccacactgcccact
gtactccgaaccttctgcctcaatgcccgcaacatcacttttgatgcctgtctaattcag
atgtttcttattcacttcttctccatgatggaatcaggtattctgctggccatgagtttt
gaccgctatgtggccatttgtgaccccttgcgctatgcaactgtgctcaccactgaagtc
attgctgcaatgggtttaggtgcagctgctcgaagcttcatcacccttttccctcttccc
tttcttattaagaggctgcctatctgcagatccaatgttctttctcactcctactgcctg
cacccagacatgatgaggcttgcctgtgctgatatcagtatcaacagcatctatggactc
tttgttcttgtatccacctttggcatggacctgttttttatcttcctctcctatgtgctc
attctgcgttctgtcatggccactgcttcccgtgaggaacgcctcaaagctctcaacaca
tgtgtgtcacatatcctggctgtacttgcattttatgtgccaatgattggggtctccaca
gtgcaccgctttgggaagcatgtcccatgctacatacatgtcctcatgtcaaatgtgtac
ctatttgtgcctcctgtgctcaaccctctcatttatagcgccaagacaaaggaaatccgc
cgagccattttccgcatgtttcaccacatcaaaatatga

DBGET integrated database retrieval system