KEGG   Homo sapiens (human): 390066Help
Entry
390066            CDS       T01001                                 

Gene name
OR52D1, OR11-43
Definition
(RefSeq) olfactory receptor family 52 subfamily D member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390066 (OR52D1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390066 (OR52D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390066
NCBI-ProteinID: NP_001005163
HGNC: 15212
Ensembl: ENSG00000181609
Vega: OTTHUMG00000066895
Pharos: Q9H346(Tdark)
UniProt: Q9H346 A0A126GVG9
Position
11p15.4
AA seq 318 aa AA seqDB search
MSDSNLSDNHLPDTFFLTGIPGLEAAHFWIAIPFCAMYLVALVGNAALILVIAMDNALHA
PMYLFLCLLSLTDLALSSTTVPKMLAILWLHAGEISFGGCLAQMFCVHSIYALESSILLA
MAFDRYVAICNPLRYTTILNHAVIGRIGFVGLFRSVAIVSPFIFLLRRLPYCGHRVMTHT
YCEHMGIARLACANITVNIVYGLTVALLAMGLDSILIAISYGFILHAVFHLPSHDAQHKA
LSTCGSHIGIILVFYIPAFFSFLTHRFGHHEVPKHVHIFLANLYVLVPPVLNPILYGART
KEIRSRLLKLLHLGKTSI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattccaacctcagtgataaccatcttccagacaccttcttcttaacagggatc
ccagggctggaggctgcccacttctggattgccatccctttctgtgccatgtatcttgta
gcactggttggaaatgctgccctcatcctggtcattgccatggacaatgctcttcatgca
cctatgtacctcttcctctgccttctctcactcacagacctggctctcagttctaccact
gtgcccaagatgctggccattttgtggctccatgctggtgagatttcctttggtggatgc
ctggcccagatgttttgtgtccattctatctatgctctggagtcctcaattctacttgcc
atggcctttgataggtatgtggctatctgtaacccattaaggtacacaaccattctcaac
catgctgtcataggcagaattggctttgttgggctattccgtagtgtggctattgtctcc
cccttcatcttcttgctgaggcgactcccctactgtggtcaccgtgtcatgacacacaca
tactgtgagcatatgggcattgcccgactggcctgtgccaacatcactgtcaatattgtc
tatgggctaactgtggctctgctggccatgggactggattccattctcattgccatttcc
tatggctttatcctccatgcagtctttcatcttccatctcatgatgcccagcacaaagct
ctgagtacctgtggctcccacattggcatcatcctggttttctacatccctgccttcttc
tccttcctcacccaccgctttggtcaccacgaagtccccaagcatgtgcacatctttctg
gctaatctctatgtgctggtgcctcctgtactcaatcctattctctatggagctagaacc
aaggagattcggagtcgacttctaaaactgcttcacctggggaagacttcaatatga

DBGET integrated database retrieval system