KEGG   Homo sapiens (human): 390072Help
Entry
390072            CDS       T01001                                 

Gene name
OR52N4, OR11-64
Definition
olfactory receptor, family 52, subfamily N, member 4
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 321 aa AA seqDB search
MLTLNKTDLIPASFILNGVPGLEDTQLWISFPFCSMYVVAMVGNCGLLYLIHYEDALHKP
MYYFLAMLSFTDLVMCSSTIPKALCIFWFHLKDIGFDECLVQMFFTHTFTGMESGVLMLM
ALDRYVAICYPLRYSTILTNPVIAKVGTATFLRGVLLIIPFTFLTKLLPYCRGNILPHTY
CDHMSVAKLSCGNVKVNAIYGLMVALLIWGFDILCITNSYTMILRAVVSLSSADARQKAF
NTCTAHICAIVFSYTPAFFSFFSHRFGEHIIPPSCHIIVANIYLLLPPTMNPIVYGVKTK
QIRDCVIRILSGSKDTKSYSM
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgctaacactgaataaaacagacctaataccagcttcatttattctgaatggagtccca
ggactggaagacacacaactctggatttccttcccattctgctctatgtatgttgtggct
atggtagggaattgtggactcctctacctcattcactatgaggatgccctgcacaaaccc
atgtactacttcttggccatgctttcctttactgaccttgttatgtgctctagtacaatc
cctaaagccctctgcatcttctggtttcatctcaaggacattggatttgatgaatgcctt
gtccagatgttcttcacccacaccttcacagggatggagtctggggtgcttatgcttatg
gccctggatcgctatgtggccatctgctaccccttacgctattcaactatcctcaccaat
cctgtaattgcaaaggttgggactgccaccttcctgagaggggtattactcattattccc
tttactttcctcaccaagctcctgccctactgcagaggcaatatacttccccatacctac
tgtgaccacatgtctgtagccaaattgtcctgtggtaatgtcaaggtcaatgccatctat
ggtctgatggttgccctcctgatttggggctttgacatactgtgtatcaccaactcctat
accatgattctccgggcagtggtcagcctctcctcagcagatgctcggcagaaggccttt
aatacctgcactgcccacatttgtgccattgttttctcctatactccagctttcttctcc
ttcttttcccaccgctttggggaacacataatccccccttcttgccacatcattgtagcc
aatatttatctgctcctaccacccactatgaaccctattgtctatggggtgaaaaccaaa
cagatacgagactgtgtcataaggatcctttcaggttctaaggataccaaatcctacagc
atgtga

DBGET integrated database retrieval system