KEGG   Homo sapiens (human): 390075Help
Entry
390075            CDS       T01001                                 

Gene name
OR52N5, OR11-62, OR52N5Q
Definition
(RefSeq) olfactory receptor family 52 subfamily N member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390075 (OR52N5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390075 (OR52N5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390075
NCBI-ProteinID: NP_001001922
HGNC: 15231
Ensembl: ENSG00000181009
Vega: OTTHUMG00000168799
Pharos: Q8NH56(Tdark)
UniProt: Q8NH56 A0A126GVK9
Position
11p15.4
AA seq 324 aa AA seqDB search
MPLFNSLCWFPTIHVTPPSFILNGIPGLERVHVWISLPLCTMYIIFLVGNLGLVYLIYYE
ESLHHPMYFFFGHALSLIDLLTCTTTLPNALCIFWFSLKEINFNACLAQMFFVHGFTGVE
SGVLMLMALDRYVAICYPLRYATTLTNPIIAKAELATFLRGVLLMIPFPFLVKRLPFCQS
NIISHTYCDHMSVVKLSCASIKVNVIYGLMVALLIGVFDICCISLSYTLILKAAISLSSS
DARQKAFSTCTAHISAIIITYVPAFFTFFAHRFGGHTIPPSLHIIVANLYLLLPPTLNPI
VYGVKTKQIRKSVIKFFQGDKGAG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcctctatttaattcattatgctggtttccaacaattcatgtgactcctccatctttt
attcttaatggaatacctggtctggaaagagtacatgtatggatctccctcccactctgc
acaatgtacatcatcttccttgtggggaatcttggtcttgtgtacctcatttattatgag
gagtccttacatcatccgatgtattttttttttggccatgctctctccctcattgacctc
cttacctgcaccaccactctacccaatgcactctgcatcttctggttcagtctcaaagaa
attaacttcaatgcttgcttggcccagatgttctttgttcatgggttcacaggtgtggag
tctggggtgctcatgctcatggctctagaccgctatgtagccatttgctaccctttgcgt
tatgctaccacactcaccaaccctatcattgccaaggctgagcttgccaccttcctgagg
ggtgtattgctgatgattcctttcccattcttggttaagcgtttgcctttctgccaaagc
aatattatctcccatacgtactgcgaccacatgtctgtagtaaagctatcttgtgccagc
atcaaggtcaatgtaatctatggtctaatggttgctctcctgattggagtgtttgacatt
tgttgtatatctttgtcttacactttgatcctcaaggcagcgatcagcctctcttcatca
gatgctcggcagaaggctttcagcacctgcactgcccatatatctgccatcatcatcacc
tatgttccagcattcttcactttctttgcccaccgttttgggggacacacaattccccct
tctcttcacatcattgtggctaatctttatcttcttcttcccccaactctaaaccctatt
gtttatggagtaaagacaaaacagatacgcaagagtgtcataaagttcttccagggtgat
aagggtgcaggttga

DBGET integrated database retrieval system