KEGG   Homo sapiens (human): 390075Help
Entry
390075            CDS       T01001                                 

Gene name
OR52N5, OR11-62, OR52N5Q
Definition
olfactory receptor, family 52, subfamily N, member 5
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 324 aa AA seqDB search
MPLFNSLCWFPTIHVTPPSFILNGIPGLERVHVWISLPLCTMYIIFLVGNLGLVYLIYYE
ESLHHPMYFFFGHALSLIDLLTCTTTLPNALCIFWFSLKEINFNACLAQMFFVHGFTGVE
SGVLMLMALDRYVAICYPLRYATTLTNPIIAKAELATFLRGVLLMIPFPFLVKRLPFCQS
NIISHTYCDHMSVVKLSCASIKVNVIYGLMVALLIGVFDICCISLSYTLILKAAISLSSS
DARQKAFSTCTAHISAIIITYVPAFFTFFAHRFGGHTIPPSLHIIVANLYLLLPPTLNPI
VYGVKTKQIRKSVIKFFQGDKGAG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcctctatttaattcattatgctggtttccaacaattcatgtgactcctccatctttt
attcttaatggaatacctggtctggaaagagtacatgtatggatctccctcccactctgc
acaatgtacatcatcttccttgtggggaatcttggtcttgtgtacctcatttattatgag
gagtccttacatcatccgatgtattttttttttggccatgctctctccctcattgacctc
cttacctgcaccaccactctacccaatgcactctgcatcttctggttcagtctcaaagaa
attaacttcaatgcttgcttggcccagatgttctttgttcatgggttcacaggtgtggag
tctggggtgctcatgctcatggctctagaccgctatgtagccatttgctaccctttgcgt
tatgctaccacactcaccaaccctatcattgccaaggctgagcttgccaccttcctgagg
ggtgtattgctgatgattcctttcccattcttggttaagcgtttgcctttctgccaaagc
aatattatctcccatacgtactgcgaccacatgtctgtagtaaagctatcttgtgccagc
atcaaggtcaatgtaatctatggtctaatggttgctctcctgattggagtgtttgacatt
tgttgtatatctttgtcttacactttgatcctcaaggcagcgatcagcctctcttcatca
gatgctcggcagaaggctttcagcacctgcactgcccatatatctgccatcatcatcacc
tatgttccagcattcttcactttctttgcccaccgttttgggggacacacaattccccct
tctcttcacatcattgtggctaatctttatcttcttcttcccccaactctaaaccctatt
gtttatggagtaaagacaaaacagatacgcaagagtgtcataaagttcttccagggtgat
aagggtgcaggttga

DBGET integrated database retrieval system