KEGG   Homo sapiens (human): 390077Help
Entry
390077            CDS       T01001                                 

Gene name
OR52N2, OR11-57
Definition
(RefSeq) olfactory receptor family 52 subfamily N member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390077 (OR52N2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390077 (OR52N2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390077
NCBI-ProteinID: NP_001005174
HGNC: 15228
Ensembl: ENSG00000180988
Vega: OTTHUMG00000168801
Pharos: Q8NGI0(Tdark)
UniProt: Q8NGI0
Position
11p15.4
AA seq 321 aa AA seqDB search
MSGDNSSSLTPGFFILNGVPGLEATHIWISLPFCFMYIIAVVGNCGLICLISHEEALHRP
MYYFLALLSFTDVTLCTTMVPNMLCIFWFNLKEIDFNACLAQMFFVHMLTGMESGVLMLM
ALDRYVAICYPLRYATILTNPVIAKAGLATFLRNVMLIIPFTLLTKRLPYCRGNFIPHTY
CDHMSVAKVSCGNFKVNAIYGLMVALLIGVFDICCISVSYTMILQAVMSLSSADARHKAF
STCTSHMCSIVITYVAAFFTFFTHRFVGHNIPNHIHIIVANLYLLLPPTMNPIVYGVKTK
QIQEGVIKFLLGDKVSFTYDK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggacaacagctccagcctgaccccaggattctttatcttgaatggcgttcct
gggctggaagccacacacatctggatctccctgccattctgctttatgtacatcattgct
gtcgtggggaactgtgggctcatctgcctcatcagccatgaggaggccctgcaccggccc
atgtactacttcctggccctgctctccttcactgatgtcaccttgtgcaccaccatggta
cctaatatgctgtgcatattctggttcaacctcaaggagattgactttaacgcctgcctg
gcccagatgttttttgtccatatgctgacagggatggagtctggggtgctcatgctcatg
gccctggaccgctatgtggccatctgctaccccttacgctatgccaccatccttaccaac
cctgtcatcgccaaggctggtcttgccaccttcttgaggaatgtgatgctcatcatccca
ttcactctcctcaccaagcgcctgccctattgccgggggaacttcatcccccacacctac
tgtgaccatatgtctgtggccaaggtatcctgtggcaatttcaaggtcaatgctatttat
ggtctgatggttgctctcctgattggtgtgtttgatatctgctgtatctctgtatcttac
actatgattttgcaggctgttatgagcctgtcatcagcagatgctcgtcacaaagccttc
agcacctgcacatctcacatgtgttccattgtgatcacctatgttgctgcttttttcact
tttttcactcatcgttttgtaggacacaatatcccaaaccacatacacatcatcgtggcc
aacctttatctgctactgcctcctaccatgaacccaattgtttatggagtcaagaccaag
cagattcaggaaggtgtaattaaatttttacttggagacaaggttagttttacctatgac
aaatga

DBGET integrated database retrieval system