KEGG   Homo sapiens (human): 390081Help
Entry
390081            CDS       T01001                                 

Gene name
OR52E4, OR11-55
Definition
(RefSeq) olfactory receptor family 52 subfamily E member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390081 (OR52E4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390081 (OR52E4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx MerC
Motif
Other DBs
NCBI-GeneID: 390081
NCBI-ProteinID: NP_001005165
HGNC: 15213
Ensembl: ENSG00000180974
Vega: OTTHUMG00000168804
Pharos: Q8NGH9(Tdark)
UniProt: Q8NGH9
Position
11p15.4
AA seq 312 aa AA seqDB search
MPSINDTHFYPPFFLLLGIPGLDTLHIWISFPFCIVYLIAIVGNMTILFVIKTEHSLHQP
MFYFLAMLSMIDLGLSTSTIPKMLGIFWFNLQEISFGGCLLQMFFIHMFTGMETVLLVVM
AYDRFVAICNPLQYTMILTNKTISILASVVVGRNLVLVTPFVFLILRLPFCGHNIVPHTY
CEHRGLAGLACAPIKINIIYGLMVISYIIVDVILIASSYVLILRAVFRLPSQDVRLKAFN
TCGSHVCVMLCFYTPAFFSFMTHRFGQNIPHYIHILLANLYVVVPPALNPVIYGVRTKQI
REQIVKIFVQKE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccttctatcaatgacacccacttctatccccccttcttcctcctgctaggaatacca
ggactggacactttacatatctggatttctttcccattctgtattgtgtacctgattgcc
attgtggggaatatgaccattctctttgtgatcaaaactgaacatagtctacaccagccc
atgttctacttcctggccatgttgtctatgattgatctgggtctgtccacatccactatc
cccaaaatgctaggaatcttctggttcaacctccaagagatcagctttgggggatgcctt
cttcagatgttctttattcacatgtttacaggcatggagactgttctgttggtggtcatg
gcttatgaccgctttgttgccatctgcaaccctctccagtacaccatgatcctcaccaat
aaaaccatcagtatcctagcttctgtggttgttggaagaaatttagttcttgtaacccca
tttgtgtttctcattctgcgtctgccattctgtgggcataacatcgtacctcacacatac
tgtgagcacaggggtctggccgggttggcctgtgcacccattaagatcaacataatctat
gggctcatggtgatttcttatattattgtggatgtgatcttaattgcctcttcctatgtg
cttatccttagagctgtttttcgccttccctctcaagatgtccgactaaaggccttcaat
acctgtggttctcatgtctgtgttatgctgtgcttttacacaccagcatttttttctttt
atgacacatcgttttggccaaaacattccccactatatccatattcttttggctaacctg
tatgtggttgtcccacctgcccttaaccctgtcatttatggagtcaggaccaagcagatc
cgagagcaaattgtgaaaatatttgtacagaaagaataa

DBGET integrated database retrieval system