KEGG   Homo sapiens (human): 390084Help
Entry
390084            CDS       T01001                                 

Gene name
OR56A5, OR56A5P
Definition
(RefSeq) olfactory receptor family 56 subfamily A member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390084 (OR56A5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390084 (OR56A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 390084
NCBI-ProteinID: NP_001139505
HGNC: 14792
Ensembl: ENSG00000188691
Vega: OTTHUMG00000165730
Pharos: P0C7T3(Tdark)
UniProt: P0C7T3 A0A126GWP3
Position
11p15.4
AA seq 313 aa AA seqDB search
MTLPSNNSTSPVFEFFLICFPSFQSWQHWLSLPLSLLFLLAMGANATLLITIYLEASLHQ
PLYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLRSISFPACFLQVFIMNSFLTMESCTFMI
MAYDRYVAICKPLQYSSIITDQFVARAAIFVVARNGLLTMPIPILSSRLRYCAGHIIKNC
ICTNVSVSKLSCDDITLNQSYQFVIGWTLLGSDLILIVLSYFFILKTVLRIKGEGDMAKA
LGTCGSHFILILFFTTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTK
EIKQGIQNLLRRL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacattacccagcaacaactccacttccccagtctttgaattcttcctcatttgtttc
cccagtttccagagctggcagcactggctgtctctgcccctcagcctcctcttcctcctg
gccatgggggccaatgccacccttctgatcaccatctatctggaagcctctctgcaccag
cccctgtactacctgctcagcctcctctccctgctggacatcgtactctgcctcaccgtc
atccccaaggtcctggccatcttctggtttgacctcagatcaatcagcttccctgcctgc
ttccttcaggtgttcatcatgaacagttttctgactatggagtcctgcacattcatgatc
atggcctatgaccgctatgtggccatctgcaagcccctacagtactcatccatcatcact
gatcaatttgtcgctagggctgccatctttgttgtggccaggaatggccttcttactatg
cctatccccatactttcttctcgactcagatactgtgcaggacacatcatcaagaactgc
atctgtactaacgtgtctgtgtctaaactctcttgtgatgacatcaccttgaatcagagc
taccagtttgttataggttggaccctgctgggctctgacctcatccttattgttctctct
tacttttttatcttgaaaactgtgctaaggattaagggtgagggagatatggccaaagct
ctaggtacttgtggttcccacttcatcctcatcctcttcttcaccacagtcctgctggtt
ctggtcatcactaacctggccaggaagagaattcctccggatgtccccatcctgctcaac
atcctgcaccaccttattcccccagctctgaaccccattgtttatggtgtgagaaccaag
gagatcaagcagggaatccagaacctgctgaggaggttgtaa

DBGET integrated database retrieval system