KEGG   Homo sapiens (human): 390142Help
Entry
390142            CDS       T01001                                 

Gene name
OR5D13
Definition
olfactory receptor, family 5, subfamily D, member 13
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390142 (OR5D13)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390142 (OR5D13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q11
AA seq 314 aa AA seqDB search
MMASERNQSSTPTFILLGFSEYPEIQVPLFLVFLFVYTVTVVGNLGMIIIIRLNSKLHTI
MCFFLSHLSLTDFCFSTVVTPKLLENLVVEYRTISFSGCIMQFCFACIFGVTETFMLAAM
AYDRFVAVCKPLLYTTIMSQKLCALLVAGSYTWGIVCSLILTYFLLDLSFCESTFINNFI
CDHSVIVSASYSDPYISQRLCFIIAIFNEVSSLIIILTSYMLIFTTIMKMRSASGRQKTF
STCASHLTAITIFHGTILFLYCVPNPKTSSLIVTVASVFYTVAIPMLNPLIYSLRNKDIN
NMFEKLVVTKLIYH
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatggcatctgaaagaaatcaaagcagcacacccacttttattctcttgggtttttca
gaatacccagaaatccaggttccactctttctggttttcttgttcgtctacacagtcact
gtagtggggaacttgggcatgataataatcatcagactcaattcaaaactccatacaatc
atgtgctttttccttagtcacttgtccttgacagacttctgtttttccactgtagttaca
cctaaactgttggagaacttggttgtggaatacagaaccatctctttctctggttgcatc
atgcaattttgttttgcttgcatttttggagtgacagaaactttcatgttagcagcgatg
gcttatgaccgttttgtggcagtttgtaaacccttgctgtataccactattatgtctcag
aagctctgtgctcttctggtggctgggtcctatacatgggggatagtgtgctccctgata
ctcacatattttcttcttgacttatcgttttgtgaatctaccttcataaataattttatc
tgtgaccactctgtaattgtttctgcctcctactcagacccctatatcagccagaggcta
tgctttattattgccatattcaatgaggtgagcagcctaattatcattctgacatcatat
atgcttattttcactaccattatgaagatgcgatctgcaagtgggcgccagaaaactttc
tccacctgtgcctcccacctgacagccatcactatcttccatggaactatccttttcctt
tactgtgttcctaatcctaaaacttctagcctcatagttacagtggcttctgtgttttac
acagtggcgattccaatgctgaacccattgatctacagccttaggaacaaagatatcaat
aacatgtttgaaaaattagttgtcaccaaattgatttaccactga

DBGET integrated database retrieval system