KEGG   Homo sapiens (human): 390142Help
Entry
390142            CDS       T01001                                 

Gene name
OR5D13
Definition
(RefSeq) olfactory receptor family 5 subfamily D member 13 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390142 (OR5D13)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390142 (OR5D13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 390142
NCBI-ProteinID: NP_001001967
HGNC: 15280
Ensembl: ENSG00000279761
Vega: OTTHUMG00000166807
Pharos: Q8NGL4(Tdark)
UniProt: Q8NGL4
Position
11q11
AA seq 314 aa AA seqDB search
MMASERNQSSTPTFILLGFSEYPEIQVPLFLVFLFVYTVTVVGNLGMIIIIRLNSKLHTI
MCFFLSHLSLTDFCFSTVVTPKLLENLVVEYRTISFSGCIMQFCFACIFGVTETFMLAAM
AYDRFVAVCKPLLYTTIMSQKLCALLVAGSYTWGIVCSLILTYFLLDLSFCESTFINNFI
CDHSVIVSASYSDPYISQRLCFIIAIFNEVSSLIIILTSYMLIFTTIMKMRSASGRQKTF
STCASHLTAITIFHGTILFLYCVPNPKTSSLIVTVASVFYTVAIPMLNPLIYSLRNKDIN
NMFEKLVVTKLIYH
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatggcatctgaaagaaatcaaagcagcacacccacttttattctcttgggtttttca
gaatacccagaaatccaggttccactctttctggttttcttgttcgtctacacagtcact
gtagtggggaacttgggcatgataataatcatcagactcaattcaaaactccatacaatc
atgtgctttttccttagtcacttgtccttgacagacttctgtttttccactgtagttaca
cctaaactgttggagaacttggttgtggaatacagaaccatctctttctctggttgcatc
atgcaattttgttttgcttgcatttttggagtgacagaaactttcatgttagcagcgatg
gcttatgaccgttttgtggcagtttgtaaacccttgctgtataccactattatgtctcag
aagctctgtgctcttctggtggctgggtcctatacatgggggatagtgtgctccctgata
ctcacatattttcttcttgacttatcgttttgtgaatctaccttcataaataattttatc
tgtgaccactctgtaattgtttctgcctcctactcagacccctatatcagccagaggcta
tgctttattattgccatattcaatgaggtgagcagcctaattatcattctgacatcatat
atgcttattttcactaccattatgaagatgcgatctgcaagtgggcgccagaaaactttc
tccacctgtgcctcccacctgacagccatcactatcttccatggaactatccttttcctt
tactgtgttcctaatcctaaaacttctagcctcatagttacagtggcttctgtgttttac
acagtggcgattccaatgctgaacccattgatctacagccttaggaacaaagatatcaat
aacatgtttgaaaaattagttgtcaccaaattgatttaccactga

DBGET integrated database retrieval system