KEGG   Homo sapiens (human): 390152Help
Entry
390152            CDS       T01001                                 

Gene name
OR8H3, OR11-172
Definition
(RefSeq) olfactory receptor family 8 subfamily H member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    390152 (OR8H3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    390152 (OR8H3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 390152
NCBI-ProteinID: NP_001005201
HGNC: 15309
Ensembl: ENSG00000181761
Vega: OTTHUMG00000166833
Pharos: Q8N146(Tdark)
UniProt: Q8N146
Position
11q12.1
AA seq 312 aa AA seqDB search
MMGRRNDTNVADFILTGLSDSEEVQMALFMLFLLIYLITMLGNVGMLLIIRLDLQLHTPM
YFFLTHLSFIDLSYSTVVTPKTLANLLTSNYISFTGCFAQMFCFVFLGTAECYLLSSMAY
DRYAAICSPLHYTVIMPKRLCLALITGPYVIGFMDSFVNVVSMSRLHFCDSNIIHHFFCD
TSPILALSCTDTDNTEMLIFIIAGSTLMVSLITISASYVSILSTILKINSTSGKQKAFST
CVSHLLGVTIFYGTMIFTYLKPRKSYSLGRDQVAPVFYTIVIPMLNPLIYSLRNREVKNA
LIRVMQRRQDSR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtagaaggaatgacacaaatgtggctgacttcatccttacgggactgtcagac
tctgaagaggtccagatggctctgtttatgctatttctcctcatatacctaattactatg
ctggggaatgtggggatgctattgataatccgcctggacctccagcttcacactcccatg
tattttttccttactcacctgtcatttattgacctcagttactcaactgtcgtcacacct
aaaaccttagcgaacttactgacttccaactatatttccttcacgggctgctttgcccag
atgttctgttttgtcttcttgggtactgctgaatgttatcttctctcctcaatggcctat
gatcgctatgcagcgatctgcagtcctctacactacacagttattatgcccaaaaggctc
tgcctcgctctcatcactgggccttatgtgattggctttatggactcctttgtcaatgtg
gtttccatgagcagattgcatttctgtgactcaaacataattcatcactttttctgtgac
acttccccaattttagctctgtcctgcactgacacagacaacactgaaatgctgatattc
attatcgctggttccaccctgatggtgtcccttatcacaatatctgcatcctatgtgtcc
attctctctaccatcctgaaaattaattccacttcaggaaagcagaaagctttctctact
tgcgtctctcatctcttgggagtcaccatcttctatggaactatgatttttacttactta
aagccaagaaagtcttattccttgggaagagatcaagtggctcctgtgttttatactatt
gtgattcccatgctgaatccactcatttatagtcttagaaacagagaagtgaaaaatgct
ctcattagagtcatgcagagaagacaggactccaggtag

DBGET integrated database retrieval system